Transcription Factor

Accessions: 5kl7_A (3D-footprint 20241219)
Names: Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19544
Length: 87
Pfam Domains: 4-28 Zinc finger, C2H2 type
4-28 C2H2-type zinc finger
21-45 Zinc-finger double domain
34-56 Zinc finger, C2H2 type
34-56 C2H2-type zinc finger
48-74 Zinc-finger double domain
62-84 C2H2-type zinc finger
62-86 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 EKPYQCDFKDCERRFSRSDRLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEK 60
61 PFSCRWPSCQKKFARSDELVRHHNMHQ
Interface Residues: 16, 17, 18, 19, 20, 22, 23, 44, 45, 46, 47, 48, 50, 51, 74, 75, 76, 77, 78, 80, 81
3D-footprint Homologues: 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 6u9q_A, 2drp_D, 8ssu_A, 2gli_A, 1tf6_A, 2jpa_A, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 2kmk_A, 5v3j_F, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 8gn3_A, 7txc_E
Binding Motifs: 5kl7_A AGCCCACGC
Binding Sites: 5kl7_B
5kl7_C
Publications: Hashimoto H, Zhang X, Zheng Y, Wilson GG, Cheng X. Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications. Nucleic Acids Res 44:10165-10176 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.