Transcription Factor
| Accessions: | 1r0n_A (3D-footprint 20231221) |
| Names: | Nuclear receptor subfamily 2 group B member 1, Retinoic acid receptor RXR-alpha, Retinoid X receptor alpha, RXRA_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P19793 |
| Length: | 78 |
| Pfam Domains: | 2-70 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 HICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRY 60 61 QKCLAMGMKREAVQAAAA |
| Interface Residues: | 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B |
| Binding Motifs: | 1r0n_AB GGnCAnTGaCC |
| Publications: | Devarakonda S, Harp J.M, Kim Y, Ozyhar A, Rastinejad F. Structure of the heterodimeric ecdysone receptor DNA-binding complex. The EMBO journal 22:5827-40 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.