Transcription Factor

Accessions: 5mhj_B (3D-footprint 20241219)
Names: Alpha-4 protein, ICP4_HHV11, Infected cell protein 4, Major viral transcription factor ICP4, Transcriptional activator IE175
Organisms: Human herpes simplex virus 1, Human herpesvirus 1 (strain 17) (HHV-1)
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08392
Length: 187
Pfam Domains: 18-183 Herpesvirus ICP4-like protein N-terminal region
Sequence: DADATSGAFYARYRDGYVSGEPWPGAGPPPPGRVLYGGLGDSRPGLWGAPEAEEARRRFE
ASGAPAAVWAPELGDAAQQYALITRLLYTPDAEAMGWLQNPRVVPGDVALDQACFRISSF
ITGSVARAVPHLGYAMAAGRFGWGLAHAAAAVAMSRRYDRAQKGFLLTSLRRAYAPLLAR
ENAALTG
Binding Motifs: 5mhj_AB aCGAt
Binding Sites: 5mhj_E
5mhj_F
Publications: Tunnicliffe RB, Lockhart-Cairns MP, Levy C, Mould AP, Jowitt TA, Sito H, Baldock C, Sandri-Goldin RM, Golovanov AP. The herpes viral transcription factor ICP4 forms a novel DNA recognition complex. Nucleic Acids Res 45:8064-8078 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.