Transcription Factor
| Accessions: | T06015 (AthalianaCistrome v4_May2016), Q9LNC9 (JASPAR 2024) |
| Names: | AT1G06180, MYB13, T06015;, AtMYB13, ATMYBL1, Myb-related protein 13, MYB13_ARATH, Transcription factor MYB13 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:MYB |
| Length: | 246 |
| Pfam Domains: | 14-61 Myb-like DNA-binding domain 17-76 Myb-like DNA-binding domain 67-112 Myb-like DNA-binding domain 70-120 Myb-like DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MGRRPCCEKIGLKKGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINY 60 61 LRPDIKRGNFTPHEEDTIISLHQLLGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLHHSQ 120 121 DQNNKEDFVSTTAAEMPTSPQQQSSSSADISAITTLGNNNDISNSNKDSATSSEDVLAII 180 181 DESFWSEVVLMDCDISGNEKNEKKIENWEGSLDRNDKGYNHDMEFWFDHLTSSSCIIGEM 240 241 SDISEF |
| Interface Residues: | 14, 49, 50, 51, 52, 54, 55, 58, 59, 60, 101, 102, 105, 106, 109, 110, 111 |
| 3D-footprint Homologues: | 3osg_A, 2kdz_A, 7xur_A, 3zqc_A, 1mse_C, 5eyb_B, 6kks_A |
| Binding Motifs: | M0534 dwddkGGTwGGTGrr M0538 yyCACCwACCmhwwhhhh MA2041.1 / UN0358.1 hwhyyCACCAACCahh MA2041.2 yCACCAACCa |
| Binding Sites: | UN0358.1.1 UN0358.1.10 MA2041.1.8 / UN0358.1.11 UN0358.1.12 MA2041.1.9 / UN0358.1.13 MA2041.1.10 / UN0358.1.14 MA2041.1.11 / UN0358.1.15 UN0358.1.16 MA2041.1.12 / UN0358.1.17 MA2041.1.13 / UN0358.1.18 UN0358.1.19 MA2041.1.1 / UN0358.1.2 MA2041.1.14 / UN0358.1.20 UN0358.1.3 MA2041.1.2 / UN0358.1.4 MA2041.1.3 / UN0358.1.5 MA2041.1.4 / UN0358.1.6 UN0358.1.7 MA2041.1.6 / UN0358.1.8 MA2041.1.7 / UN0358.1.9 MA2041.1.15 MA2041.1.16 MA2041.1.17 MA2041.1.18 MA2041.1.19 MA2041.1.20 MA2041.1.5 MA2041.2.1 MA2041.2.10 MA2041.2.11 MA2041.2.12 MA2041.2.13 / MA2041.2.14 / MA2041.2.19 MA2041.2.15 / MA2041.2.16 MA2041.2.17 MA2041.2.18 MA2041.2.2 MA2041.2.20 MA2041.2.3 MA2041.2.4 MA2041.2.5 MA2041.2.6 MA2041.2.7 MA2041.2.8 MA2041.2.9 |
| Publications: | Zhou J, Lee C, Zhong R, Ye ZH. MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis. Plant Cell 21:248-66 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.