Transcription Factor
| Accessions: | YY1 (HT-SELEX2 May2017), TYY1_HUMAN (HOCOMOCO 10), YY1 (humanC2H2ZF-ChIP Feb2015), P25490 (JASPAR 2024) |
| Names: | ENSG00000100811, YY1, Delta transcription factor, INO80 complex subunit S, NF-E1, Transcriptional repressor protein YY1, TYY1_HUMAN, Yin and yang 1, YY-1, P25490 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, humanC2H2ZF-ChIP Feb2015 3, JASPAR 2024 4 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 4 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P25490 |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4, TF family: C2H2 experiment: ChIP-seq/MEME/B1H-RC |
| Length: | 414 |
| Pfam Domains: | 297-320 C2H2-type zinc finger 325-347 Zinc finger, C2H2 type 325-347 C2H2-type zinc finger 340-365 Zinc-finger double domain 353-377 C2H2-type zinc finger 353-377 Zinc finger, C2H2 type 369-395 Zinc-finger double domain 383-407 C2H2-type zinc finger 383-407 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG 60 61 GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG 120 121 LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS 180 181 GKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE 240 241 QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH 300 301 KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC 360 361 GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ |
| Interface Residues: | 274, 275, 278, 308, 309, 310, 311, 312, 314, 315, 316, 317, 318, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 347, 361, 364, 365, 366, 367, 368, 369, 371, 372, 376, 393, 395, 396, 397, 398, 399, 400, 401, 402 |
| 3D-footprint Homologues: | 2i13_A, 7w1m_H, 6wmi_A, 5ei9_F, 6ml4_A, 8gn3_A, 7eyi_G, 4m9v_C, 6e94_A, 7ysf_A, 2jpa_A, 1ubd_C, 8ssq_A, 8ssu_A, 5kkq_D, 1tf3_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 1mey_C, 7txc_E, 5kl3_A, 2kmk_A, 5und_A, 2gli_A, 1tf6_A, 6blw_A, 4x9j_A, 8h9h_G, 2lt7_A, 7y3m_I, 6a57_A, 4gnx_Z, 5k5i_A, 3uk3_C, 2drp_D, 1f2i_J, 5yj3_D, 1g2f_F, 5v3j_F, 1llm_D, 2wbs_A, 6u9q_A, 5yel_A |
| Binding Motifs: | MA0095.2 cAArATGGCkgc YY1_3 ggcCGCCATyTTGd YY1_4 cgCCATyTTkgrcwwwwyGTGCk YY1_methyl_1 gkCsGCCATyTTGk YY1_methyl_2 cgCCATyTTkGrCrwwwhGTGCt TYY1_HUMAN.H10MO.A|M01587 cAArATGGCggc YY1_ChIP GCcGCCATsTTg MA0095.1 rCCATc |
| Binding Sites: | MA0095.1.1 MA0095.1.10 MA0095.1.11 MA0095.1.12 MA0095.1.13 MA0095.1.14 MA0095.1.15 MA0095.1.16 MA0095.1.17 MA0095.1.2 MA0095.1.3 MA0095.1.4 MA0095.1.5 MA0095.1.6 MA0095.1.7 MA0095.1.8 MA0095.1.9 MA0095.2.1 MA0095.2.10 MA0095.2.11 MA0095.2.12 MA0095.2.13 MA0095.2.14 MA0095.2.15 MA0095.2.16 MA0095.2.17 MA0095.2.18 MA0095.2.19 MA0095.2.2 MA0095.2.20 MA0095.2.3 MA0095.2.4 MA0095.2.5 MA0095.2.6 MA0095.2.7 MA0095.2.8 MA0095.2.9 |
| Publications: | Shrivastava A., Calame K. An analysis of genes regulated by the multi-functional transcriptional regulator Yin Yang-1. Nucleic Acids Res. 22:5151-5155 (1994). [Pubmed] Kim J., Kim J. YY1's longer DNA-binding motifs.. Genomics 93:152-158 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.