Transcription Factor

Accessions: 1gcc_A (3D-footprint 20231221)
Names: AtERF1A, EF100_ARATH, EREBP-1A, ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1, Ethylene-responsive element-binding factor 1A, Ethylene-responsive transcription factor 1A
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O80337
Length: 63
Pfam Domains: 2-52 AP2 domain
Sequence:
(in bold interface residues)
1 KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFP 60
61 LRV
Interface Residues: 7, 9, 10, 11, 15, 17, 19, 22, 27, 29
3D-footprint Homologues: 5wx9_A, 7wq5_A, 1gcc_A, 7et4_D
Binding Motifs: 1gcc_A TGGCGGCTA
Binding Sites: 1gcc_B
1gcc_C
Publications: Allen M.D, Yamasaki K, Ohme-Takagi M, Tateno M, Suzuki M. A novel mode of DNA recognition by a beta-sheet revealed by the solution structure of the GCC-box binding domain in complex with DNA. The EMBO journal 17:5484-96 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.