Transcription Factor

Accessions: 1bvo_A (3D-footprint 20231221)
Names: AGAP009515-PA, Immune factor, Q17034_ANOGA, TRANSCRIPTION FACTOR GAMBIF1
Organisms: Anopheles funestus, Anopheles gambiae
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q17034
Length: 175
Pfam Domains: 3-174 Rel homology domain (RHD)
Sequence:
(in bold interface residues)
1 PYVEITEQPHPKALRFRYECEGRSAGSIPGVNTTAEQKTFPSIQVHGYRGRAVVVVSCVT 60
61 KEGPEHKPHPHNLVGKEGCKKGVCTVEINSTTMSYTFNNLGIQCVKKKDVEEALRLRQEI 120
121 RVDPFRTGFGHAKEPGSIDLNAVRLCFQVFLEGQQRGRFTEPLTPVVSDIIYDKK
Interface Residues: 15, 17, 18, 20, 21, 23, 24, 25, 175
3D-footprint Homologues: 2o61_A, 1a3q_A, 2ram_A, 1gji_A, 7cli_B, 1nfk_A
Binding Motifs: 1bvo_A TGGGA
Publications: Cramer P, Varrot A, Barillas-Mury C, Kafatos F.C, Müller C.W. Structure of the specificity domain of the Dorsal homologue Gambif1 bound to DNA. Structure (London, England : 1993) 7:841-52 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.