Transcription Factor

Accessions: CG5669 (FlyZincFinger 1.0 )
Names: CG5669
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 130
Pfam Domains: 29-53 C2H2-type zinc finger
45-72 Zinc-finger double domain
59-83 Zinc finger, C2H2 type
59-83 C2H2-type zinc finger
76-98 Zinc-finger double domain
89-111 C2H2-type zinc finger
89-111 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 EPKPRLKRVACTCPNCTDGEKHSDKKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFV 60
61 CSWAFCGKRFTRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTHFKSRSGVEL 120
121 IELSIKQETK
Interface Residues: 15, 17, 21, 41, 42, 43, 44, 45, 47, 48, 50, 51, 54, 70, 71, 72, 73, 74, 75, 77, 78, 79, 82, 99, 100, 101, 102, 103, 104, 105, 106, 107
3D-footprint Homologues: 7w1m_H, 7ysf_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 5kkq_D, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 1ubd_C, 8ssq_A, 6blw_A, 2kmk_A, 1llm_D, 6u9q_A, 5yel_A, 8ssu_A, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 2jpa_A, 8gn3_A, 5k5i_A, 7y3l_A, 3uk3_C, 8cuc_F, 1f2i_J, 2wbs_A, 7txc_E, 2drp_D, 4m9v_C, 5yj3_D
Binding Motifs: CG5669_SANGER_10_FBgn0039169 drkGGGCGkGGYcwm
CG5669_SOLEXA_5_FBgn0039169 rgkGGGCGkGGCywm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.