Transcription Factor
Accessions: | 4h10_B (3D-footprint 20241219) |
Names: | bHLHe8, Circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, CLOCK_HUMAN, EC 2.3.1.48, hCLOCK |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | O15516 |
Length: | 63 |
Pfam Domains: | 5-53 Helix-loop-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 KDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAW 60 61 LEH |
Interface Residues: | 9, 10, 12, 13, 16, 17, 21, 40 |
3D-footprint Homologues: | 8osl_O, 7d8t_A, 7xi3_A, 7f2f_B, 7xi3_B, 5v0l_A, 7ssa_L, 7xq5_A, 7xhv_B, 8osl_P, 5v0l_B |
Binding Motifs: | 4h10_AB TCACGtG 4h10_B CAcg |
Binding Sites: | 4h10_C 4h10_D |
Publications: | Wang Z, Wu Y, Li L, Su X.D. Intermolecular recognition revealed by the complex structure of human CLOCK-BMAL1 basic helix-loop-helix domains with E-box DNA. Cell research : (2012). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.