Transcription Factor

Accessions: 4h10_B (3D-footprint 20260701)
Names: bHLHe8, Circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, CLOCK_HUMAN, EC 2.3.1.48, hCLOCK
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O15516
Length: 63
Pfam Domains: 5-53 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 KDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAW 60
61 LEH
Interface Residues: 4, 6, 8, 9, 10, 12, 13, 15, 16, 17, 21, 40
3D-footprint Homologues: 4zpr_B, 1a0a_B, 4zpk_B, 7f2f_B, 5eyo_A, 1am9_A, 7xi3_B, 4zpk_A, 7ssa_L, 7xq5_A, 6g1l_A, 7xhv_B, 5nj8_D, 4h10_A, 8osl_O, 7d8t_A, 7xi3_A, 5v0l_A, 4h10_B, 2ql2_A, 8osl_P, 5nj8_C, 5v0l_B
Binding Motifs: 4h10_AB TCACGtG
4h10_B CAcg
Binding Sites: 4h10_C
4h10_D
Publications: Wang Z, Wu Y, Li L, Su X.D. Intermolecular recognition revealed by the complex structure of human CLOCK-BMAL1 basic helix-loop-helix domains with E-box DNA. Cell research : (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.