Transcription Factor
| Accessions: | 3nm9_D (3D-footprint 20231221), 3nm9_G (3D-footprint 20231221), 3nm9_J (3D-footprint 20231221) |
| Names: | High mobility group protein D, HMG-D, HMGD_DROME |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q05783 |
| Length: | 73 |
| Pfam Domains: | 2-64 Domain of unknown function (DUF1898) 4-69 HMG (high mobility group) box |
| Sequence: (in bold interface residues) | 1 SDKPKRPLSAYALWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKD 60 61 DYDRAVKEFEANG |
| Interface Residues: | 6, 9, 11, 12, 15, 19, 30, 31, 32, 35 |
| 3D-footprint Homologues: | 6jrp_D, 2gzk_A, 3u2b_C, 1j5n_A, 7m5w_A, 3f27_D, 4s2q_D, 1o4x_B, 3tmm_A, 4y60_C, 1qrv_A, 3tq6_B, 1hry_A, 1ckt_A |
| Binding Motifs: | 3nm9_DGJ CGnnngATannnCG |
| Binding Sites: | 3nm9_H 3nm9_I |
| Publications: | Churchill M.E, Klass J, Zoetewey D.L. Structural analysis of HMGD-DNA complexes reveals influence of intercalation on sequence selectivity and DNA bending. Journal of molecular biology 403:88-102 (2010). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.