Transcription Factor

Accessions: 5k5i_A (3D-footprint 20241219)
Names: 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P49711
Length: 113
Pfam Domains: 3-25 C2H2-type zinc finger
3-25 Zinc finger, C2H2 type
3-26 C2H2-type zinc-finger domain
18-42 Zinc-finger double domain
31-54 C2H2-type zinc finger
61-84 Zinc finger, C2H2 type
61-84 C2H2-type zinc finger
92-113 Zinc finger, C2H2 type
92-113 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 SPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAK 60
61 FHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSH
Interface Residues: 3, 13, 14, 15, 16, 17, 19, 20, 28, 41, 42, 43, 44, 45, 47, 48, 71, 72, 73, 74, 75, 78, 81, 82, 102, 104, 105, 106, 108
3D-footprint Homologues: 2kmk_A, 7y3l_A, 8cuc_F, 7n5w_A, 7ysf_A, 1tf3_A, 6u9q_A, 1tf6_A, 8ssu_A, 5v3j_F, 1ubd_C, 8gn3_A, 2jpa_A, 8h9h_G, 8ssq_A, 2lt7_A, 2gli_A, 7y3m_I, 6e94_A, 7w1m_H, 1yuj_A, 2drp_D, 7txc_E, 8bx1_A
Binding Motifs: 5k5i_A CCCTGcyGG
Binding Sites: 5k5i_B
5k5i_C
Publications: Hashimoto H, Wang D, Horton JR, Zhang X, Corces VG, Cheng X. Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Mol Cell 66:711-720 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.