Transcription Factor
| Accessions: | TFAP2C_DBD (HumanTF 1.0), TFAP2C_TF1 (HumanTF2 1.0), TFAP2C (HT-SELEX2 May2017) |
| Names: | activating enhancerbinding protein 2 gamma, B2RAN6_HUMAN, cDNA, FLJ95025, highly similar to Homo sapiens transcription factor AP-2 gamma, TFAP2C, ENSG00000087510 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2, HT-SELEX2 May2017 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 3 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | B2RAN6 |
| Notes: | Ensembl ID: ENSG00000087510; DNA-binding domain sequence; TF family: AP2; Clone source: Gene synthesis, Ensembl ID: ENSG00000087510; Construct type: TF1(SBP); TF family: AP2; Clone source: Jolma et al. 2013, TF family: TFAP experiment: HT-SELEX Hamming distance: 1 cycle: 4b0, TF family: TFAP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4b0 |
| Length: | 240 |
| Pfam Domains: | 16-223 Transcription factor AP-2 |
| Sequence: (in bold interface residues) | 1 LNLPCQKELVGAVMNPTEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGG 60 61 VLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVTLLTSLVEGEAVHLARDFAYVCEAE 120 121 FPSKPVAEYLTRPHLGGRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLET 180 181 NIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEK 240 |
| Interface Residues: | 31, 65, 66 |
| 3D-footprint Homologues: | 8j0k_B |
| Binding Motifs: | TFAP2C_DBD_1 tGCCyyrrGGCa TFAP2C_DBD_2 hGCCtsAGGCw TFAP2C_DBD_3 tGCCCysrGGGCa TFAP2C_DLX3_1 yssCysvrGGCaygggssTAATkr TFAP2C_DLX3_2 gsCCysrRGscaygskrTAATkr TFAP2C_DLX3_2_3 msCCybmrGsCaygcsymATTA TFAP2C_DRGX sCCysrGGsrayaATTA TFAP2C_E2F8 ttTCCCGCbmsCCcsmGGs TFAP2C_ELK1 yGCCksrGGsgrCGGAAGyg TFAP2C_ETV7 sCYbsrGGssrcGGAAgyvytTCCks TFAP2C_HES7_1 srCaCGyGycsyrtssCCysrGGs TFAP2C_HES7_2 srCACGyGccywtssCCysrGGs TFAP2C_HOXB13 sCCksrRGGCRTcGTwAa TFAP2C_MAX_1 trsCCysrGGsgrkCACGTGs TFAP2C_MAX_2 trsCCysrGGssrwrCACGTGs TFAP2C_MAX_2_3 tgsCCysrGGssawrbsssssrrsCACGTGs TFAP2C_MAX_2_3_4 tgsCCysrGGssayrysssvssrrsCACGTG TFAP2C_ONECUT2_1 rATCGATaytkhsCCksrrGssk TFAP2C_ONECUT2_2 rrTCGATvygbttksCCygrGGskr TFAP2C_ONECUT2_2_3 tATCGAyyggwyrtysCCysrGGsga TFAP2C_ONECUT2_2_3_4 tATyGATygbycbrtysCCysrGGsbv TFAP2C_2 ysCyysmrGsr TFAP2C_methyl_1 ysCCysrGGsr |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.