Transcription Factor

Accessions: 1yo5_C (3D-footprint 20231221)
Names: Prostate epithelium-specific Ets transcription factor, Prostate-derived Ets factor, Prostate-specific Ets, SAM pointed domain containing ets transcription factor, SAM pointed domain-containing Ets transcription factor, SPDEF_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O95238
Length: 88
Pfam Domains: 3-87 Ets-domain
Sequence:
(in bold interface residues)
1 QPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLS 60
61 RSIRQYYKKGIIRKPDISQRLVYQFVHP
Interface Residues: 57, 58, 60, 61, 62, 64, 65, 80
3D-footprint Homologues: 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A
Binding Motifs: 1yo5_C tCCt
Binding Sites: 1yo5_A
1yo5_B
Publications: Wang Y, Feng L, Said M, Balderman S, Fayazi Z, Liu Y, Ghosh D, Gulick A.M. Analysis of the 2.0 A crystal structure of the protein-DNA complex of the human PDEF Ets domain bound to the prostate specific antigen regulatory site. Biochemistry 44:7095-106 (2005). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.