Transcription Factor
Accessions: | 1yo5_C (3D-footprint 20231221) |
Names: | Prostate epithelium-specific Ets transcription factor, Prostate-derived Ets factor, Prostate-specific Ets, SAM pointed domain containing ets transcription factor, SAM pointed domain-containing Ets transcription factor, SPDEF_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | O95238 |
Length: | 88 |
Pfam Domains: | 3-87 Ets-domain |
Sequence: (in bold interface residues) | 1 QPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLS 60 61 RSIRQYYKKGIIRKPDISQRLVYQFVHP |
Interface Residues: | 57, 58, 60, 61, 62, 64, 65, 80 |
3D-footprint Homologues: | 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A |
Binding Motifs: | 1yo5_C tCCt |
Binding Sites: | 1yo5_A 1yo5_B |
Publications: | Wang Y, Feng L, Said M, Balderman S, Fayazi Z, Liu Y, Ghosh D, Gulick A.M. Analysis of the 2.0 A crystal structure of the protein-DNA complex of the human PDEF Ets domain bound to the prostate specific antigen regulatory site. Biochemistry 44:7095-106 (2005). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.