Transcription Factor

Accessions: 6jhe_A (3D-footprint 20231221)
Names: Alternative RNA polymerase sigma factor SigW, ECF RNA polymerase sigma factor SigW, ECF sigma factor SigW, RNA polymerase sigma-W factor, SIGW_BACSU
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q45585
Length: 53
Pfam Domains: 1-47 Sigma-70, region 4
3-49 Sigma-70, region 4
Sequence:
(in bold interface residues)
1 ILKLPDKYRTVIVLKYIDELSLIEIGEILNIPVGTVKTRIHRGREALRKQLRD
Interface Residues: 22, 34, 35, 37, 38, 41, 42, 43, 44, 45, 48
3D-footprint Homologues: 6jhe_A, 2h27_A, 1tc3_C
Binding Motifs: 6jhe_A GTtTCA
Binding Sites: 6jhe_B
6jhe_C
Publications: Kwon E, Devkota SR, Pathak D, Dahal P, Kim DY. Structural analysis of the recognition of the -35 promoter element by SigW from Bacillus subtilis. PLoS One : (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.