Transcription Factor
| Accessions: | 5kl3_A (3D-footprint 20260701) |
| Names: | Wilms tumor protein, WT1_HUMAN, WT33 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P19544 |
| Length: | 87 |
| Pfam Domains: | 3-27 C2H2-type zinc finger 3-27 Zinc finger, C2H2 type 19-44 Zinc-finger double domain 33-55 C2H2-type zinc finger 33-55 Zinc finger, C2H2 type 33-53 Zinc-finger of C2H2 type 47-73 Zinc-finger double domain 61-83 C2H2-type zinc finger 61-85 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 KPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKP 60 61 FSCRWPSCQKKFARSDELVRHHNMHQR |
| Interface Residues: | 11, 13, 15, 16, 17, 18, 19, 21, 22, 43, 44, 45, 46, 47, 48, 49, 50, 51, 73, 74, 75, 76, 77, 78, 79, 80, 81 |
| 3D-footprint Homologues: | 5yel_A, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 8cuc_F, 6u9q_A, 8ssu_A, 2drp_D, 5kkq_D, 4x9j_A, 2gli_A, 1f2i_J, 5kl3_A, 1tf6_A, 5ei9_F, 2jpa_A, 7ysf_A, 1g2f_F, 6ml4_A, 8ssq_A, 1ubd_C, 7w1m_H, 6blw_A, 5k5i_A, 2kmk_A, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 8gn3_A, 3uk3_C, 5yj3_D, 2wbs_A, 7txc_E, 1llm_D, 4m9v_C |
| Binding Motifs: | 5kl3_A GCGTGGGAGt |
| Binding Sites: | 5kl3_B 5kl3_C |
| Publications: | Hashimoto H, Zhang X, Zheng Y, Wilson GG, Cheng X. Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications. Nucleic Acids Res 44:10165-10176 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.