Transcription Factor

Accessions: 5kl3_A (3D-footprint 20260701)
Names: Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19544
Length: 87
Pfam Domains: 3-27 C2H2-type zinc finger
3-27 Zinc finger, C2H2 type
19-44 Zinc-finger double domain
33-55 C2H2-type zinc finger
33-55 Zinc finger, C2H2 type
33-53 Zinc-finger of C2H2 type
47-73 Zinc-finger double domain
61-83 C2H2-type zinc finger
61-85 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 KPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKP 60
61 FSCRWPSCQKKFARSDELVRHHNMHQR
Interface Residues: 11, 13, 15, 16, 17, 18, 19, 21, 22, 43, 44, 45, 46, 47, 48, 49, 50, 51, 73, 74, 75, 76, 77, 78, 79, 80, 81
3D-footprint Homologues: 5yel_A, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 8cuc_F, 6u9q_A, 8ssu_A, 2drp_D, 5kkq_D, 4x9j_A, 2gli_A, 1f2i_J, 5kl3_A, 1tf6_A, 5ei9_F, 2jpa_A, 7ysf_A, 1g2f_F, 6ml4_A, 8ssq_A, 1ubd_C, 7w1m_H, 6blw_A, 5k5i_A, 2kmk_A, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 8gn3_A, 3uk3_C, 5yj3_D, 2wbs_A, 7txc_E, 1llm_D, 4m9v_C
Binding Motifs: 5kl3_A GCGTGGGAGt
Binding Sites: 5kl3_B
5kl3_C
Publications: Hashimoto H, Zhang X, Zheng Y, Wilson GG, Cheng X. Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications. Nucleic Acids Res 44:10165-10176 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.