Transcription Factor

Accessions: 3mfk_A (3D-footprint 20231221)
Names: ETS1_HUMAN, p54, Protein C-ets-1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14921
Length: 138
Pfam Domains: 34-115 Ets-domain
Sequence:
(in bold interface residues)
1 GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGW 60
61 EFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL 120
121 LGYTPEELHAMLDVKPDA
Interface Residues: 31, 64, 68, 69, 72, 86, 87, 89, 90, 91, 93, 94, 108
3D-footprint Homologues: 3zp5_A, 2wbs_A, 4uno_A, 3jtg_A, 7jsa_J, 2stt_A, 8ee9_F, 4mhg_A, 1dux_F, 4l18_B, 1yo5_C, 1awc_A, 4lg0_B, 4bqa_A, 1bc8_C, 4iri_A
Binding Motifs: 3mfk_AB AGGAagnnnnTCC
Publications: Babayeva N.D, Wilder P.J, Shiina M, Mino K, Desler M, Ogata K, Rizzino A, Tahirov T.H. Structural basis of Ets1 cooperative binding to palindromic sequences on stromelysin-1 promoter DNA. Cell cycle (Georgetown, Tex.) 9:3054-62 (2010). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.