Transcription Factor
| Accessions: | 4h10_A (3D-footprint 20231221) |
| Names: | Aryl hydrocarbon receptor nuclear translocator-like protein 1, Basic-helix-loop-helix-PAS protein MOP3, bHLH-PAS protein JAP3, bHLHe5, BMAL1_HUMAN, Brain and muscle ARNT-like 1, Class E basic helix-loop-helix protein 5, Member of PAS protein 3, PAS domain-containing protein 3 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | O00327 |
| Length: | 60 |
| Pfam Domains: | 6-57 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 RIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA 60 |
| Interface Residues: | 6, 8, 9, 10, 12, 13, 16, 17, 21, 41, 43 |
| 3D-footprint Homologues: | 7z5k_B, 1a0a_B, 1an4_A, 4zpr_B, 1am9_A, 7ssa_L, 5nj8_D, 4h10_B, 7xq5_A, 6g1l_A, 5eyo_A, 5sy7_B, 4zpk_A, 7d8t_A, 5gnj_I, 7xi3_A, 5v0l_A, 8osl_O, 7f2f_B, 4h10_A, 8osl_P, 2ypa_A, 5nj8_C, 7xhv_B, 4zpk_B, 7xi3_B, 5v0l_B |
| Binding Motifs: | 4h10_A TCAcg 4h10_AB TCACGtG |
| Binding Sites: | 4h10_C 4h10_D |
| Publications: | Wang Z, Wu Y, Li L, Su X.D. Intermolecular recognition revealed by the complex structure of human CLOCK-BMAL1 basic helix-loop-helix domains with E-box DNA. Cell research : (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.