Transcription Factor

Accessions: FOXC2_DBD (HumanTF 1.0), FOXC2 (HT-SELEX2 May2017)
Names: Forkhead box protein C2, Forkhead-related protein FKHL14, FOXC2, FOXC2_HUMAN, Mesenchyme fork head protein 1, MFH-1 protein, Transcription factor FKH-14, ENSG00000176692
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q99958
Notes: Ensembl ID: ENSG00000176692; DNA-binding domain sequence; TF family: Forkhead; Clone source: Gene synthesis, TF family: Forkhead experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Forkhead experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 132
Pfam Domains: 18-113 Fork head domain
Sequence:
(in bold interface residues)
1 SYAPYHHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQ 60
61 GWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVS 120
121 KEKEERAHLKEP
Interface Residues: 41, 58, 60, 61, 63, 64, 65, 67, 68, 69, 71, 72, 81, 88, 109, 113
3D-footprint Homologues: 8vfz_O, 3l2c_A, 8bzm_E, 7vox_H, 2hdc_A, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 8sro_B, 3qrf_G
Binding Motifs: FOXC2_DBD_1 wrtmAATATTkAyw
FOXC2_DBD_2 rTAAAyAAACA
FOXC2_DBD_3 wAwrTAAAYAww
FOXC2_3 bwamryMAACAm
FOXC2_4 ryAAAyAAACAm
FOXC2_methyl_1 ywacrymAACAw
FOXC2_methyl_2 rymmAyAAACAh
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.