Transcription Factor

Accessions: MSC_full (HumanTF 1.0)
Names: ABF-1, Activated B-cell factor 1, bHLHa22, Class A basic helix-loop-helix protein 22, MSC, MUSC_HUMAN, Musculin
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: O60682
Notes: Ensembl ID: ENSG00000178860; Full protein sequence; TF family: bHLH; Clone source: hORFeome
Length: 207
Pfam Domains: 108-160 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA 60
61 LGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM 120
121 RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW 180
181 PFVVSGRPDSDTKEVSAANRLCGTTA*
Interface Residues: 109, 112, 113, 115, 116, 117, 118, 119, 120
3D-footprint Homologues: 7z5k_B, 8osb_B, 2ypa_A, 6od3_F, 2ypa_B, 2ql2_A, 2ql2_D, 5nj8_C, 5v0l_B
Binding Motifs: MSC_full AACAGCTGTT
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.