Transcription Factor

						

			
Accessions: 6df8_A (3D-footprint 20231221)

			
Names: KAISO_HUMAN, Transcriptional regulator Kaiso, Zinc finger and BTB domain-containing protein 33
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q86T24
Length: 118
Pfam Domains:     27-50 Zinc-finger double domain
    41-63 C2H2-type zinc finger
    57-79 Zinc-finger double domain
    69-92 C2H2-type zinc finger
    69-92 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHE   60
  61 IHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAY
Interface Residues: 13, 23, 24, 25, 26, 27, 29, 30, 32, 33, 36, 51, 52, 53, 54, 55, 56, 57, 58, 59, 79, 80, 81, 82, 83, 84, 85, 86, 87, 90, 114, 116
3D-footprint Homologues: 2kmk_A, 6jnm_A, 1tf3_A, 6ml4_A, 7n5w_A, 4x9j_A, 2i13_A, 6e94_A, 5kl3_A, 1ubd_C, 7ysf_A, 6wmi_A, 5ei9_F, 8ssq_A, 1mey_C, 7w1m_H, 5und_A, 2drp_D, 7eyi_G, 5k5i_A, 8ssu_A, 2gli_A, 1g2f_F, 6blw_A, 5kkq_D, 1tf6_A, 6u9q_A, 8h9h_G, 5v3j_F, 2lt7_A, 6a57_A, 8gn3_A, 2jpa_A, 3uk3_C, 8cuc_F, 7y3l_A, 5yel_A, 1llm_D, 7txc_E, 2wbs_A, 1f2i_J, 4m9v_C, 7y3m_I, 5yj3_D
Binding Motifs: 6df8_A TGGCAGGA
Binding Sites: 6df8_D
6df8_E
			
Publications: Nikolova EN, Stanfield RL, Dyson HJ, Wright PE. A Conformational Switch in the Zinc Finger Protein Kaiso Mediates Differential Readout of Specific and Methylated DNA Sequences. Biochemistry 59:1909-1926 (2020). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.