Transcription Factor

Accessions: BARX2 (HT-SELEX2 May2017), Q9UMQ3 (JASPAR 2024)
Names: BARX2, ENSG00000043039, BARX2_HUMAN
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1, JASPAR 2024 2
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q9UMQ3
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 279
Pfam Domains: 134-190 Homeobox domain
Sequence:
(in bold interface residues)
1 MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHS 60
61 CTGSPSLRAYPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSE 120
121 SETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTW 180
181 YQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQ 240
241 EELCEAQEPKARDVPLEMAEPPDPPQELPIPSSEPPPLS
Interface Residues: 91, 115, 118, 119, 122, 125, 134, 135, 136, 137, 138, 175, 176, 178, 179, 182, 183, 186, 187, 190
3D-footprint Homologues: 1zgw_A, 5zfz_A, 1ig7_A, 2h1k_B, 6a8r_A, 3cmy_A, 3d1n_M, 1fjl_B, 1puf_A, 3lnq_A, 2lkx_A, 1jgg_B, 1mnm_C, 1nk2_P, 1zq3_P, 6m3d_C, 7q3o_C, 6es3_K, 2ld5_A, 3a01_E, 5hod_A, 1puf_B, 2hdd_A, 5jlw_D, 3rkq_B, 2r5y_A, 4xrs_G, 2hos_A, 4cyc_A, 1b72_A, 5flv_I, 1e3o_C, 1au7_A, 7xrc_C, 2xsd_C, 1le8_A, 5zjt_E, 4qtr_D, 1le8_B, 7psx_B, 1du0_A, 4xrm_B, 1k61_B, 3l1p_A, 8g87_X
Binding Motifs: BARX2_2 / MA1471.1 awwAAymRTTAs
BARX2_methyl_1 awwAAymrTTAm
MA1471.2 wAAymRTTA
Publications: Meech R, Kallunki P, Edelman GM, Jones FS. A binding site for homeodomain and Pax proteins is necessary for L1 cell adhesion molecule gene expression by Pax-6 and bone morphogenetic proteins. Proc Natl Acad Sci U S A 96:2420-5 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.