Transcription Factor
| Accessions: | TFAP4_DBD (HumanTF 1.0), TFAP4_TF1 (HumanTF2 1.0), TFAP4 (HT-SELEX2 May2017) |
| Names: | Q6FHM5_HUMAN, TFAP4, ENSG00000090447 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2, HT-SELEX2 May2017 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 3 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q6FHM5 |
| Notes: | Ensembl ID: ENSG00000090447; DNA-binding domain sequence; TF family: bHLH; Clone source: hDBD_G, Ensembl ID: ENSG00000090447; Construct type: TF1(SBP); TF family: bHLH; Clone source: Jolma et al. 2013, TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 117 |
| Pfam Domains: | 24-75 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 GGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSK 60 61 AAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDI |
| Interface Residues: | 25, 27, 28, 29, 31, 32, 35, 36, 60, 103 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 8osb_B, 1an4_A, 5eyo_A, 8ia3_B, 7f2f_B, 5i50_B, 4h10_A, 1am9_A, 7d8t_A, 2ypa_B, 2ql2_A, 8osl_P, 2ql2_D, 5gnj_I, 7ssa_L, 6g1l_A, 1jfi_B |
| Binding Motifs: | TFAP4_DBD AwCAGCTGwt TFAP4_DLX3_1 kCAGsTGdvggrsgyaATkr TFAP4_DLX3_2 yCAGsTGkdbgkrsgtaATtr TFAP4_DLX3_2_3 AwCAGCTGATywTAATtr TFAP4_DLX3_2_3_4 AwCAGCTGwTysssgYaatkr TFAP4_ETV1 rsCGGAwgCAGsTGgk TFAP4_ETV4 rsCGGAwvCAgsTGkb TFAP4_FLI1_1 rscGGAwrCAgsTGg TFAP4_FLI1_2 acCGGAAACAGCTGwy TFAP4_MAX_1 yCAGCTGrmvrsCACGTGs TFAP4_MAX_2 dCAGCTGwbmrgmgCACGTGs TFAP4_MAX_2_3 wCAsCTGdtbssCACGTGs TFAP4_3 awCAGCTGwt TFAP4_4 ahCAkaTGdt TFAP4_7 awCAGCTGwt TFAP4_8 ahCAyrTGkt TFAP4_methyl_1 AwCAGCTGwT TFAP4_methyl_2 awCAtaTGwt TFAP4_methyl_5 awCAGCTGwt TFAP4_methyl_6 ahCAyaTGdt |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.