Transcription Factor
| Accessions: | KLF14 (HT-SELEX2 May2017) |
| Names: | ENSG00000174595, KLF14 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 122 |
| Pfam Domains: | 16-40 Zinc finger, C2H2 type 16-40 C2H2-type zinc finger 32-59 Zinc-finger double domain 46-70 C2H2-type zinc finger 46-70 Zinc finger, C2H2 type 63-87 Zinc-finger double domain 66-103 BED zinc finger 76-98 C2H2-type zinc finger 76-98 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 DQAPRRRSVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRS 60 61 DELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPP 120 121 LT |
| Interface Residues: | 6, 28, 29, 30, 31, 32, 34, 35, 37, 38, 41, 58, 59, 60, 61, 62, 64, 65, 66, 69, 86, 87, 88, 89, 90, 91, 92, 93, 94, 97, 113, 116 |
| 3D-footprint Homologues: | 1ubd_C, 6jnm_A, 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 5ei9_F, 8ssq_A, 7w1m_H, 1mey_C, 5und_A, 5k5i_A, 2kmk_A, 8ssu_A, 6ml4_A, 2gli_A, 1g2f_F, 6blw_A, 5kkq_D, 1tf6_A, 6u9q_A, 4x9j_A, 2i13_A, 5kl3_A, 7ysf_A, 7eyi_G, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6wmi_A, 6a57_A, 2jpa_A, 3uk3_C, 2drp_D, 1f2i_J, 5yel_A, 7txc_E, 1llm_D, 2wbs_A, 4m9v_C, 8gn3_A, 5v3j_F, 5yj3_D |
| Binding Motifs: | KLF14_2 srcCaCGCCCmcy KLF14_methyl_1 crcCaCrCCCmcc |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.