Transcription Factor
| Accessions: | GRF9 (EEADannot 2025-07-22) |
| Names: | ZmGRF9;GRFTF9;GRMZM2G124566_T02 |
| Organisms: | Zea mays |
| Libraries: | EEADannot 2025-07-22 1 1 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed] |
| Notes: | family:C3H zinc finger factors GRF |
| Length: | 221 |
| Pfam Domains: | 69-105 QLQ 135-179 WRC |
| Sequence: | MAEDKETDSPQPPAKLPRLSRADTSAGEVTMAASSPLVLGLGLGLGGRGGGGERDADVSP ATVTPKRPSALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWKSVAASSFGPQRFPSL MGLGSLCFDYRSSMEPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEAA AAPAAAAGGSSPVLRVAAPQHVLGLSSPTSVLLAHGAARAT |
| Binding Motifs: | EEAD0391 gYGTCAGw EEAD0392 gYGTCAGw |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.