Transcription Factor
| Accessions: | ECK120008667 (RegulonDB 7.5) |
| Names: | NanR, NanR DNA-binding transcriptional dual regulator |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The genes regulated by NanR, N-acetyl-neuraminic acid regulator, are involved in N-acetyl-neuraminic acid (or sialic acid) transport and metabolism Kalivoda KA,2003and in off-to-on switching of type 1 fimbriation; NanR is inactivated by N-acetyl-neuraminic acid Sohanpal BK,2004NanR is a member of the FadR/GntR family; Members of this family have two domains, an N-terminal domain with a helix-turn-helix DNA-binding motif and a C-terminal domain with dimerization and effector-binding motifs; Three-dimensional models of the N terminus of FadR and NanR show topological similarity and a ~26% sequence identity between them Kalivoda KA,2003NanR regulates transcription when it binds to a region of ~30 bp that contains three conserved motifs in tandem; However, this protein can be displaced from this region by N-acetyl-neuraminic acid; Although it has been shown that NanR can form homodimers in solution, its DNA-binding stoichiometry is unknown; When this protein is repressing transcription, it overlaps the whole promoter region Kalivoda KA,2003; Sohanpal BK,2004The region of 30 bp that NanR binds to is close to a Dam methylation site (GATC) Chu D,2008; Sohanpal BK,2004that appears to be necessary for induction of some genes of the NanR regulon Oshima T,2002 Methylation in these sites is prevented by NanR binding Chu D,2008; Sohanpal BK,2004; Transcription related; DNA binding; sequence-specific DNA binding transcription factor activity; intracellular; regulation of transcription, DNA-dependent; protein-DNA complex; transcription, DNA-dependent; operon; repressor |
| Length: | 264 |
| Pfam Domains: | 32-95 Bacterial regulatory proteins, gntR family 125-246 FCD domain |
| Sequence: (in bold interface residues) | 1 MGLMNAFDSQTEDSSPAIGRNLRSRPLARKKLSEMVEEELEQMIRRREFGEGEQLPSERE 60 61 LMAFFNVGRPSVREALAALKRKGLVQINNGERARVSRPSADTIIGELSGMAKDFLSHPGG 120 121 IAHFEQLRLFFESSLVRYAAEHATDEQIDLLAKALEINSQSLDNNAAFIRSDVDFHRVLA 180 181 EIPGNPIFMAIHVALLDWLIAARPTVTDQALHEHNNVSYQQHIAIVDAIRRHDPDEADRA 240 241 LQSHLNSVSATWHAFGQTTNKKK* |
| Interface Residues: | 57, 58, 59, 62, 68, 69, 70, 71, 72, 73, 74, 88, 89, 91 |
| 3D-footprint Homologues: | 6wg7_G, 8r7y_A, 4wwc_B, 4h0e_A, 4p9u_F, 1h9t_B, 4u0y_B, 7bhy_A, 8tvy_M |
| Binding Motifs: | NanR AmAGG |
| Binding Sites: | ECK120012561 ECK120012563 ECK120012565 ECK120012569 ECK120012571 ECK120012573 |
| Publications: | Chu D., Roobol J., Blomfield IC. A theoretical interpretation of the transient sialic acid toxicity of a nanR mutant of Escherichia coli. J Mol Biol. 375(3):875-89 (2008). [Pubmed] Oshima T., Wada C., Kawagoe Y., Ara T., Maeda M., Masuda Y., Hiraga S., Mori H. Genome-wide analysis of deoxyadenosine methyltransferase-mediated control of gene expression in Escherichia coli. Mol Microbiol. 45(3):673-95 (2002). [Pubmed] Sohanpal BK., El-Labany S., Lahooti M., Plumbridge JA., Blomfield IC. Integrated regulatory responses of fimB to N-acetylneuraminic (sialic) acid and GlcNAc in Escherichia coli K-12. Proc Natl Acad Sci U S A. 101(46):16322-7 (2004). [Pubmed] Kalivoda KA., Steenbergen SM., Vimr ER., Plumbridge J. Regulation of sialic acid catabolism by the DNA binding protein NanR in Escherichia coli. J Bacteriol. 185(16):4806-15 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.