Transcription Factor

Accessions: PIT1_HUMAN (HOCOMOCO 10), P28069 (JASPAR 2024)
Names: GHF-1, Growth hormone factor 1, PIT-1, PIT1_HUMAN, Pituitary-specific positive transcription factor 1
Organisms: Homo sapiens
Libraries: HOCOMOCO 10 1, JASPAR 2024 2
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 291
Pfam Domains: 125-198 Pou domain - N-terminal to homeobox domain
215-271 Homeobox domain
Sequence:
(in bold interface residues)
1 MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHY 60
61 GNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEE 120
121 PIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF 180
181 KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPS 240
241 SQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Interface Residues: 150, 166, 167, 168, 169, 171, 172, 174, 175, 178, 182, 215, 216, 217, 218, 256, 257, 259, 260, 263, 264, 267, 268, 271
3D-footprint Homologues: 3d1n_M, 7u0g_M, 3l1p_A, 7xrc_C, 1e3o_C, 8g87_X, 1au7_A, 2xsd_C, 1o4x_A, 2d5v_B, 5zfz_A, 3cmy_A, 1fjl_B, 6a8r_A, 1ig7_A, 2lkx_A, 1zq3_P, 1nk2_P, 7q3o_C, 2ld5_A, 6es3_K, 3a01_E, 2h1k_B, 1jgg_B, 3lnq_A, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 5flv_I, 2hos_A, 1b72_A, 5hod_A, 1le8_A, 4qtr_D, 1puf_A, 7psx_B, 5zjt_E, 4cyc_A, 1du0_A
Binding Motifs: MA0784.1 awTATGCwAATkAg
PIT1_HUMAN.H10MO.C|M01434 ytmaTGaAWAWwy
MA0784.2 avCTmATTwGCATAwt
MA0784.3 CTmATTwGCATAwt
Publications: Ingraham H. A., Flynn S. E., Voss J. W., Albert V. R., Kapiloff M. S., Wilson L., Rosenfeld M. G. The POU-specific domain of Pit-1 is essential for sequence-specific, high affinity DNA binding and DNA-dependent Pit-1-Pit-1 interactions. Cell 61:1021-1033 (1990). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.