Transcription Factor

						

			
Accessions: 3dfx_A (3D-footprint 20231221), 3dfx_B (3D-footprint 20231221)

			
Names: GATA-binding factor 3, GATA3_MOUSE, Trans-acting T-cell-specific transcription factor GATA-3
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P23772
Length: 58
Pfam Domains:     10-42 GATA zinc finger
Sequence: 
(in bold interface residues)		   1 SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRN
Interface Residues: 19, 20, 22, 32, 36, 37, 40, 57
3D-footprint Homologues: 1gat_A, 3dfx_B, 4gat_A, 3vd6_C
Binding Motifs: 3dfx_AB TTATCTCTGATTT
3dfx_B TTGATAA
Binding Sites: 3dfx_X
3dfx_Y
			
Publications: Bates D.L, Chen Y, Kim G, Guo L, Chen L. Crystal structures of multiple GATA zinc fingers bound to DNA reveal new insights into DNA recognition and self-association by GATA. Journal of molecular biology 381:1292-306 (2008). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.