Transcription Factor

Accessions: 2z33_A (3D-footprint 20250804)
Names: PHOB_ECOLI, Phosphate regulon transcriptional regulatory protein phoB
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0AFJ5
Length: 104
Pfam Domains: 26-100 Transcriptional regulatory protein, C terminal
Sequence:
(in bold interface residues)
1 MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWG 60
61 TNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Interface Residues: 67, 68, 69, 71, 72, 73, 75, 76, 94
3D-footprint Homologues: 8jo2_H, 8hih_Q, 4kfc_B, 6lxn_A, 8hml_B, 4nhj_A, 7e1b_B, 5ed4_A, 8hig_A, 2z33_A, 8uvk_B, 5x5l_H
Binding Motifs: 2z33_A TGTcnnA
Binding Sites: 2z33_B
2z33_C
Publications: Yamane T, Okamura H, Ikeguchi M, Nishimura Y, Kidera A. Water-mediated interactions between DNA and PhoB DNA-binding/transactivation domain: NMR-restrained molecular dynamics in explicit water environment. Proteins 71:1970-83 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.