Transcription Factor

Accessions: T061912_1.02 (CISBP 1.02)
Names: T061912_1.02;, ZFA45
Organisms: PBM CONSTRUCTS
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 88
Pfam Domains: 4-19 Zinc-finger double domain
7-30 C2H2-type zinc finger
8-30 Zinc finger, C2H2 type
8-30 C2H2-type zinc finger
22-46 Zinc-finger double domain
35-58 C2H2-type zinc finger
36-58 C2H2-type zinc finger
36-58 Zinc finger, C2H2 type
51-75 Zinc-finger double domain
63-86 C2H2-type zinc finger
64-86 C2H2-type zinc finger
64-86 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 SRPGEKPYKCPECGKSFSTSGNLVRHQRTHTGEKPYKCPECGKSFSQKSSLIAHQRTHTG 60
61 EKPYKCPECGKSFSTTGNLTVHQRTHTG
Interface Residues: 4, 5, 8, 18, 19, 20, 21, 22, 24, 25, 26, 46, 47, 48, 49, 50, 51, 52, 53, 54, 74, 75, 76, 77, 78, 79, 80, 81, 85
3D-footprint Homologues: 1yuj_A, 2kmk_A, 1tf3_A, 6ml4_A, 5v3j_F, 7n5w_A, 6jnm_A, 3uk3_C, 7ysf_A, 2drp_D, 8ssq_A, 1f2i_J, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 1g2f_F, 5kkq_D, 1ubd_C, 8gn3_A, 5ei9_F, 2jpa_A, 1llm_D, 5kl3_A, 5k5i_A, 4m9v_C, 8h9h_G, 2lt7_A, 1tf6_A, 6e94_A, 6a57_A, 8cuc_F, 7y3l_A, 5yel_A, 2wbs_A, 5yj3_D, 7txc_E, 7y3m_I
Binding Motifs: M0562_1.02 ATrTAGmw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.