Transcription Factor
| Accessions: | 1ea4_E (3D-footprint 20260701), 1ea4_L (3D-footprint 20260701) |
| Names: | TRANSCRIPTIONAL REPRESSOR COPG, COPG_STRAG, Protein CopG, Protein RepA |
| Organisms: | Streptococcus agalactiae |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P13920 |
| Length: | 44 |
| Pfam Domains: | 4-41 Ribbon-helix-helix protein, copG family |
| Sequence: (in bold interface residues) | 1 MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQE |
| Interface Residues: | 4, 6, 8, 17, 27, 28, 29, 30, 32, 33 |
| 3D-footprint Homologues: | 1b01_B, 6ido_B |
| Binding Motifs: | 1ea4_DEFG GtTGCAnnnnGTGCAAG 1ea4_HKL yGCAtnnnGTCCA |
| Binding Sites: | 1ea4_U 1ea4_V |
| Publications: | Costa M, Solà M, del Solar G, Eritja R, Hernández-Arriaga A.M, Espinosa M, Gomis-Rüth F.X, Coll M. Plasmid transcriptional repressor CopG oligomerises to render helical superstructures unbound and in complexes with oligonucleotides. Journal of molecular biology 310:403-17 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.