Transcription Factor
Accessions: | 6ml2_A (3D-footprint 20241219) |
Names: | Bone morphogenetic protein-induced factor 1, Brain-specific protein 1, ZBT24_MOUSE, Zinc finger and BTB domain-containing protein 24, Zinc finger protein 450 |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q80X44 |
Length: | 139 |
Pfam Domains: | 4-14 C2H2-type zinc finger 4-26 Zinc finger, C2H2 type 4-26 C2H2-type zinc finger 31-52 C2H2-type zinc finger 31-52 C2H2-type zinc finger 31-51 Zinc-finger of C2H2 type 45-68 Zinc-finger double domain 57-81 C2H2-type zinc finger 58-80 Zinc finger, C2H2 type 58-80 C2H2-type zinc finger 58-80 Zinc-finger of C2H2 type 72-96 Zinc-finger double domain 86-97 C2H2-type zinc finger 86-108 Zinc finger, C2H2 type 86-108 C2H2-type zinc finger 102-124 Zinc-finger double domain 114-134 C2H2-type zinc finger 114-136 Zinc finger, C2H2 type 114-136 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 SKSFTCDQCGKYFSQKRQLKSHYRVHTSLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTC 60 61 EICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCPECG 120 121 LQFARLDNLKAHLKIHSKE |
Interface Residues: | 14, 15, 16, 17, 18, 21, 40, 41, 42, 43, 44, 46, 47, 49, 50, 53, 58, 68, 69, 70, 71, 72, 74, 75, 79, 96, 97, 98, 99, 100, 102, 103, 124, 125, 126, 127, 128, 130, 131, 134 |
3D-footprint Homologues: | 5v3j_F, 8ssu_A, 1tf6_A, 8ssq_A, 7w1m_H, 8cuc_F, 7y3l_A, 7n5w_A, 8gn3_A, 2gli_A, 8h9h_G, 7y3m_I, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 2kmk_A, 1tf3_A, 6u9q_A, 2lt7_A, 2drp_D, 7txc_E |
Binding Motifs: | 6ml2_A cAGGTCCtGG |
Binding Sites: | 6ml2_E 6ml2_F |
Publications: | Ren R, Hardikar S, Horton JR, Lu Y, Zeng Y, Singh AK, Lin K, Coletta LD, Shen J, Lin Kong CS, Hashimoto H, Zhang X, Chen T, Cheng X. Structural basis of specific DNA binding by the transcription factor ZBTB24. Nucleic Acids Res 47:8388-8398 (2019). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.