Transcription Factor

Accessions: 6ml2_A (3D-footprint 20250804)
Names: Bone morphogenetic protein-induced factor 1, Brain-specific protein 1, ZBT24_MOUSE, Zinc finger and BTB domain-containing protein 24, Zinc finger protein 450
Organisms: Mus musculus
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q80X44
Length: 139
Pfam Domains: 4-26 Zinc finger, C2H2 type
4-26 C2H2-type zinc finger
4-14 C2H2-type zinc finger
31-52 C2H2-type zinc finger
31-52 C2H2-type zinc finger
31-51 Zinc-finger of C2H2 type
45-68 Zinc-finger double domain
57-81 C2H2-type zinc finger
58-80 Zinc finger, C2H2 type
58-80 C2H2-type zinc finger
58-80 Zinc-finger of C2H2 type
72-96 Zinc-finger double domain
86-97 C2H2-type zinc finger
86-108 Zinc finger, C2H2 type
86-108 C2H2-type zinc finger
102-124 Zinc-finger double domain
114-134 C2H2-type zinc finger
114-136 Zinc finger, C2H2 type
114-136 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 SKSFTCDQCGKYFSQKRQLKSHYRVHTSLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTC 60
61 EICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCPECG 120
121 LQFARLDNLKAHLKIHSKE
Interface Residues: 14, 15, 16, 17, 18, 21, 40, 41, 42, 43, 44, 46, 47, 49, 50, 53, 58, 68, 69, 70, 71, 72, 74, 75, 76, 79, 96, 97, 98, 99, 100, 101, 102, 103, 104, 124, 125, 126, 127, 128, 130, 131, 134
3D-footprint Homologues: 5v3j_F, 5kkq_D, 1tf6_A, 8ssq_A, 7w1m_H, 5yel_A, 8ssu_A, 7n5w_A, 3uk3_C, 8cuc_F, 7y3l_A, 8gn3_A, 4x9j_A, 2gli_A, 1f2i_J, 5kl3_A, 5ei9_F, 6ml4_A, 8h9h_G, 7y3m_I, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 2kmk_A, 1tf3_A, 6jnm_A, 1g2f_F, 6blw_A, 5k5i_A, 1llm_D, 6u9q_A, 4m9v_C, 2lt7_A, 6a57_A, 2wbs_A, 7txc_E, 2drp_D, 5yj3_D
Binding Motifs: 6ml2_A cAGGTCCtGG
Binding Sites: 6ml2_E
6ml2_F
Publications: Ren R, Hardikar S, Horton JR, Lu Y, Zeng Y, Singh AK, Lin K, Coletta LD, Shen J, Lin Kong CS, Hashimoto H, Zhang X, Chen T, Cheng X. Structural basis of specific DNA binding by the transcription factor ZBTB24. Nucleic Acids Res 47:8388-8398 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.