Transcription Factor

						

			
Accessions: 6ml2_A (3D-footprint 20231221)

			
Names: Bone morphogenetic protein-induced factor 1, Brain-specific protein 1, ZBT24_MOUSE, Zinc finger and BTB domain-containing protein 24, Zinc finger protein 450
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q80X44
Length: 139
Pfam Domains:      4-14 C2H2-type zinc finger
     4-26 Zinc finger, C2H2 type
     4-26 C2H2-type zinc finger
    31-51 Zinc-finger of C2H2 type
    31-52 C2H2-type zinc finger
    31-52 C2H2-type zinc finger
    45-68 Zinc-finger double domain
    57-81 C2H2-type zinc finger
    58-80 Zinc-finger of C2H2 type
    58-80 Zinc finger, C2H2 type
    58-80 C2H2-type zinc finger
    72-96 Zinc-finger double domain
   86-108 C2H2-type zinc finger
    86-97 C2H2-type zinc finger
   86-108 Zinc finger, C2H2 type
  102-124 Zinc-finger double domain
  114-136 C2H2-type zinc finger
  114-134 C2H2-type zinc finger
  114-136 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 SKSFTCDQCGKYFSQKRQLKSHYRVHTSLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTC   60
  61 EICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCPECG  120
 121 LQFARLDNLKAHLKIHSKE
Interface Residues: 14, 15, 16, 17, 18, 21, 40, 41, 42, 43, 44, 46, 47, 49, 50, 53, 58, 68, 69, 70, 71, 72, 74, 75, 76, 79, 96, 97, 98, 99, 100, 101, 102, 103, 104, 124, 125, 126, 127, 128, 130, 131, 134
3D-footprint Homologues: 5v3j_F, 5yel_A, 6wmi_A, 8ssq_A, 7w1m_H, 8ssu_A, 5kkq_D, 1tf6_A, 2i13_A, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 4x9j_A, 5kl3_A, 5ei9_F, 5und_A, 1f2i_J, 6ml4_A, 2gli_A, 8gn3_A, 8h9h_G, 7eyi_G, 6e94_A, 7ysf_A, 7y3m_I, 2jpa_A, 1ubd_C, 2kmk_A, 6jnm_A, 1tf3_A, 1llm_D, 1mey_C, 5k5i_A, 1g2f_F, 6blw_A, 6u9q_A, 4m9v_C, 2lt7_A, 6a57_A, 7txc_E, 2wbs_A, 2drp_D, 5yj3_D
Binding Motifs: 6ml2_A cAGGTCCtGG
Binding Sites: 6ml2_E
6ml2_F
			
Publications: Ren R, Hardikar S, Horton JR, Lu Y, Zeng Y, Singh AK, Lin K, Coletta LD, Shen J, Lin Kong CS, Hashimoto H, Zhang X, Chen T, Cheng X. Structural basis of specific DNA binding by the transcription factor ZBTB24. Nucleic Acids Res 47:8388-8398 (2019). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.