Transcription Factor

Accessions: 2hos_B (3D-footprint 20250804), 2hot_B (3D-footprint 20250804)
Names: HMEN_DROME, Segmentation polarity homeobox protein engrailed
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P02836
Length: 58
Pfam Domains: 1-57 Homeobox domain
Sequence:
(in bold interface residues)
1 KRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRAKIKKS
Interface Residues: 1, 2, 3, 4, 42, 43, 45, 46, 49, 50, 52, 53, 54, 57
3D-footprint Homologues: 8ejp_B, 6a8r_A, 1fjl_B, 8pmf_A, 5zfz_A, 1ig7_A, 3cmy_A, 3lnq_A, 6m3d_C, 1zq3_P, 2lkx_A, 1jgg_B, 2ld5_A, 5hod_A, 2hdd_A, 2r5y_A, 8osb_E, 1au7_A, 5jlw_D, 3rkq_B, 2hos_A, 1nk2_P, 8eml_B, 6es3_K, 4xrs_G, 3a01_E, 7psx_B, 1b72_A, 4cyc_A, 5flv_I, 2d5v_B, 9b8u_A, 7q3o_C, 5zjt_E, 4j19_B, 1puf_A, 8ik5_C, 1e3o_C, 1le8_A, 1mnm_C, 4qtr_D, 1puf_B, 1k61_B, 1o4x_A, 8g87_X, 6fqp_B, 1le8_B, 1du0_A, 6fqq_E
Binding Motifs: 2hos_AB TCCnnGGATTA
2hot_AB TAATCcnngG
Binding Sites: 2hos_C / 2hot_C
2hos_D / 2hot_D
Publications: Simon M.D, Feldman M.E, Rauh D, Maris A.E, Wemmer D.E, Shokat K.M. Structure and properties of a re-engineered homeodomain protein-DNA interface. ACS chemical biology 1:755-60 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.