Transcription Factor
Accessions: | 2hos_B (3D-footprint 20231221), 2hot_B (3D-footprint 20231221) |
Names: | HMEN_DROME, Segmentation polarity homeobox protein engrailed |
Organisms: | Drosophila melanogaster |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P02836 |
Length: | 58 |
Pfam Domains: | 1-57 Homeobox domain |
Sequence: (in bold interface residues) | 1 KRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRAKIKKS |
Interface Residues: | 1, 2, 3, 4, 42, 43, 45, 46, 49, 50, 53, 54, 57 |
3D-footprint Homologues: | 1ig7_A, 6a8r_A, 3cmy_A, 2h1k_B, 5zfz_A, 1fjl_B, 6m3d_C, 1jgg_B, 2lkx_A, 1zq3_P, 3lnq_A, 2ld5_A, 3a01_E, 2d5v_B, 5jlw_D, 3rkq_B, 1puf_A, 6es3_K, 4xrs_G, 7psx_B, 4cyc_A, 1au7_A, 5flv_I, 2hdd_A, 1nk2_P, 7q3o_C, 5zjt_E, 4j19_B, 2r5y_A, 1b72_A, 5hod_A, 2hos_A, 1e3o_C, 1le8_A, 4qtr_D, 1le8_B, 1du0_A, 1mnm_C, 1puf_B, 1k61_B, 6fqp_B, 3l1p_A, 6fqq_E, 1o4x_A, 8g87_X |
Binding Motifs: | 2hos_AB TCCnnGGATTA 2hot_AB TAATCcnngG |
Binding Sites: | 2hos_C / 2hot_C 2hos_D / 2hot_D |
Publications: | Simon M.D, Feldman M.E, Rauh D, Maris A.E, Wemmer D.E, Shokat K.M. Structure and properties of a re-engineered homeodomain protein-DNA interface. ACS chemical biology 1:755-60 (2006). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.