Transcription Factor

Accessions: T049082_1.02 (CISBP 1.02)
Names: Osr2, T049082_1.02;
Organisms: Mus musculus
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 276
Pfam Domains: 172-194 C2H2-type zinc finger
172-194 Zinc finger, C2H2 type
186-210 Zinc-finger double domain
200-222 Zinc finger, C2H2 type
200-222 C2H2-type zinc finger
214-237 Zinc-finger double domain
228-250 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPS 60
61 VHEITRSTITEMAAAQGLVDARFPFPSLPFATHLFHPKQGAIAHVLPALHKDRPRFDFAN 120
121 LAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLNPDRKPSRGRLPSKTKKEFICKFCGRH 180
181 FTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQS 240
241 RTLAVHKTLHMQTSSPTAASSAAKCSGETAICGGTA
Interface Residues: 44, 46, 152, 153, 154, 155, 157, 158, 161, 162, 172, 182, 183, 184, 185, 186, 188, 189, 190, 195, 196, 197, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 221, 238, 239, 240, 241, 242, 243, 245
3D-footprint Homologues: 4kdp_B, 6kdb_D, 2jpa_A, 1ubd_C, 2kmk_A, 6ml4_A, 8cuc_F, 7y3l_A, 6jnm_A, 3uk3_C, 7n5w_A, 1tf3_A, 1tf6_A, 2gli_A, 1g2f_F, 5kkq_D, 6u9q_A, 4x9j_A, 1llm_D, 5kl3_A, 5ei9_F, 2drp_D, 6blw_A, 5k5i_A, 4m9v_C, 5v3j_F, 8h9h_G, 2lt7_A, 7ysf_A, 6e94_A, 7y3m_I, 6a57_A, 7w1m_H, 1yuj_A, 5yel_A, 8ssq_A, 2wbs_A, 5yj3_D, 8gn3_A, 1f2i_J, 7txc_E
Binding Motifs: M0396_1.02 aacrGtAGcw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.