Transcription Factor

						

			
Accessions: 1jj4_A (3D-footprint 20231221)

			
Names: Regulatory protein E2, VE2_HPV18
Organisms: Human papillomavirus type 18
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06790
Length: 74
Pfam Domains:      3-74 E2 (early) protein, C terminal
Sequence: 
(in bold interface residues)		   1 MTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTKTGILTVTYHSETQRTKFLNTV   60
  61 AIPDSVQILVGYMT
Interface Residues: 12, 15, 16, 19, 20, 36, 38, 40, 48, 52, 53, 54, 55, 57
3D-footprint Homologues: 1jj4_B, 2ayg_A, 2bop_A, 6ukf_X, 8him_B
Binding Motifs: 1jj4_AB CAACCGnntnCGGTTG
			
Publications: Kim S.S, Tam J.K, Wang A.F, Hegde R.S. The structural basis of DNA target discrimination by papillomavirus E2 proteins. The Journal of biological chemistry 275:31245-54 (2000). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.