Transcription Factor
| Accessions: | 1jj4_A (3D-footprint 20250804) |
| Names: | Regulatory protein E2, VE2_HPV18 |
| Organisms: | Human papillomavirus type 18 |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P06790 |
| Length: | 74 |
| Pfam Domains: | 3-74 E2 (early) protein, C terminal |
| Sequence: (in bold interface residues) | 1 MTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTKTGILTVTYHSETQRTKFLNTV 60 61 AIPDSVQILVGYMT |
| Interface Residues: | 12, 15, 16, 19, 20, 36, 38, 40, 48, 52, 53, 54, 55, 57 |
| 3D-footprint Homologues: | 1jj4_B, 2ayg_A, 2bop_A, 6ukf_X, 8him_B |
| Binding Motifs: | 1jj4_AB CAACCGnntnCGGTTG |
| Publications: | Kim S.S, Tam J.K, Wang A.F, Hegde R.S. The structural basis of DNA target discrimination by papillomavirus E2 proteins. The Journal of biological chemistry 275:31245-54 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.