Transcription Factor
| Accessions: | 1b72_B (3D-footprint 20231221) |
| Names: | Homeobox protein PBX1, Homeobox protein PRL, PBX1_HUMAN, Pre-B-cell leukemia transcription factor 1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P40424 |
| Length: | 73 |
| Pfam Domains: | 1-59 Homeobox domain 18-56 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 RKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKN 60 61 IGKFQEEANIYAA |
| Interface Residues: | 1, 2, 3, 4, 44, 45, 47, 48, 51, 52, 55, 56, 59 |
| 3D-footprint Homologues: | 2lkx_A, 3d1n_M, 1zq3_P, 6fqp_B, 3cmy_A, 1b72_A, 1puf_B, 6a8r_A, 5zfz_A, 4j19_B, 1au7_A, 5zjt_E, 5jlw_D, 2ld5_A, 1le8_A, 1ig7_A, 7q3o_C, 1ic8_B, 4qtr_D, 2h1k_B, 6fqq_E, 5hod_A, 3rkq_B, 8g87_X, 4xrm_B, 2hdd_A, 1le8_B, 6m3d_C, 1du0_A, 4cyc_A, 2r5y_A, 1jgg_B, 6es3_K, 4xrs_G, 3l1p_A, 1mnm_C, 7psx_B, 1fjl_B, 3a01_E, 2d5v_B, 1k61_B, 5flv_I, 3lnq_A, 1puf_A, 2hos_A |
| Binding Motifs: | 1b72_AB ATGATTGAA 1b72_B aTCAt |
| Binding Sites: | 1b72_D 1b72_E |
| Publications: | Piper D.E, Batchelor A.H, Chang C.P, Cleary M.L, Wolberger C. Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation. Cell 96:587-97 (1999). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.