Transcription Factor

Accessions: 1mdy_B (3D-footprint 20231221), 1mdy_C (3D-footprint 20231221), 1mdy_D (3D-footprint 20231221)
Names: MYOD BHLH DOMAIN, MYOD1_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P10085
Length: 62
Pfam Domains: 6-57 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 TTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALL 60
61 RD
Interface Residues: 7, 10, 11, 13, 14, 15, 17, 18
3D-footprint Homologues: 7z5k_B, 2ypa_A, 5i50_B, 4h10_A, 6od3_F, 5eyo_A, 1am9_A, 2ql2_A, 2ql2_D, 8osl_P, 2ypa_B, 5gnj_I
Binding Motifs: 1mdy_AB CanntG
1mdy_CD CAnnTGt
Binding Sites: 1mdy_E / 1mdy_F / 1mdy_G / 1mdy_H
Publications: Ma P. C. M., Rould M. A., Weintraub H., Pabo C. O. Crystal structure of MyoD bHLH domain-DNA complex: perspectives on DNA recognition and implications for transcriptional activation. Cell 77:451-459 (1994). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.