Transcription Factor
| Accessions: | T037008_1.02 (CISBP 1.02), Q96289 (JASPAR 2024), T03500 (AthalianaCistrome v4_May2016) |
| Names: | STZ, T037008_1.02;, Salt-tolerance zinc finger, ZAT10_ARATH, Zinc finger protein ZAT10, AT1G27730, T03500; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | experiment type:PBM, family:C2H2 ZF, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:C2H2 |
| Length: | 227 |
| Pfam Domains: | 80-102 Zinc finger, C2H2 type 80-103 Zinc-finger of C2H2 type 80-102 C2H2-type zinc finger 80-104 C2H2-type zinc finger 136-156 C2H2-type zinc finger 136-160 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MALEALTSPRLASPIPPLFEDSSVFHGVEHWTKGKRSKRSRSDFHHQNLTEEEYLAFCLM 60 61 LLARDNRQPPPPPAVEKLSYKCSVCDKTFSSYQALGGHKASHRKNLSQTLSGGGDDHSTS 120 121 SATTTSAVTTGSGKSHVCTICNKSFPSGQALGGHKRCHYEGNNNINTSSVSNSEGAGSTS 180 181 HVSSSHRGFDLNIPPIPEFSMVNGDDEVMSPMPAKKPRFDFPVKLQL |
| Interface Residues: | 80, 90, 91, 92, 93, 94, 97, 104, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 130, 146, 147, 148, 149, 150, 151, 153 |
| 3D-footprint Homologues: | 2kmk_A, 6ml4_A, 4x9j_A, 5v3j_F, 8gh6_A, 6e94_A, 7ysf_A, 7w1m_H, 7txc_E, 5yel_A, 8ssq_A, 7y3l_A, 8cuc_F |
| Binding Motifs: | M0370_1.02 gasTrwr M0302 / MA1372.1 yWsthhCASTm M0304 wsttCACT MA1372.2 yWsthhCAST |
| Binding Sites: | MA1372.1.1 MA1372.1.10 MA1372.1.11 MA1372.1.12 MA1372.1.13 MA1372.1.14 MA1372.1.15 MA1372.1.16 MA1372.1.17 MA1372.1.18 MA1372.1.19 MA1372.1.2 MA1372.1.20 MA1372.1.3 MA1372.1.4 MA1372.1.5 MA1372.1.6 MA1372.1.7 MA1372.1.8 MA1372.1.9 MA1372.2.1 MA1372.2.10 MA1372.2.11 MA1372.2.12 MA1372.2.13 MA1372.2.14 MA1372.2.15 MA1372.2.16 MA1372.2.17 MA1372.2.18 MA1372.2.19 MA1372.2.2 MA1372.2.20 MA1372.2.3 MA1372.2.4 MA1372.2.5 MA1372.2.6 MA1372.2.7 MA1372.2.8 MA1372.2.9 |
| Publications: | Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.