Transcription Factor
| Accessions: | SOX6_TF1 (HumanTF2 1.0), SOX6_TF2 (HumanTF2 1.0) |
| Names: | SOX6, SOX6_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Uniprot: | P35712 |
| Notes: | Ensembl ID: ENSG00000110693; Construct type: TF1(SBP); TF family: HMG; Clone source: MGC, Ensembl ID: ENSG00000110693; Construct type: TF2(3xFLAG); TF family: SOX; Clone source: MGC |
| Length: | 106 |
| Pfam Domains: | 19-87 HMG (high mobility group) box 20-77 Domain of unknown function (DUF1898) |
| Sequence: (in bold interface residues) | 1 AEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSM 60 61 SNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIG |
| Interface Residues: | 21, 24, 26, 27, 28, 30, 34, 45, 46, 47, 50, 52, 53, 55, 57, 58, 74, 88 |
| 3D-footprint Homologues: | 3f27_D, 1qrv_A, 3u2b_C, 7m5w_A, 2gzk_A, 4s2q_D, 1j5n_A, 2lef_A, 4y60_C, 1o4x_B, 1ckt_A, 1hry_A, 6jbx_A |
| Binding Motifs: | SOX6 caccgAACAAT SOX6_TBX21_1 rgGTGtkryttwdksywTTGT SOX6_TBX21_2 rgGTGtkrwwdwdrACAATrg TEAD4_SOX6 rrACAATrgaawGGwATGy |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.