Transcription Factor

Accessions: SOX6_TF1 (HumanTF2 1.0), SOX6_TF2 (HumanTF2 1.0)
Names: SOX6, SOX6_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: P35712
Notes: Ensembl ID: ENSG00000110693; Construct type: TF1(SBP); TF family: HMG; Clone source: MGC, Ensembl ID: ENSG00000110693; Construct type: TF2(3xFLAG); TF family: SOX; Clone source: MGC
Length: 106
Pfam Domains: 19-87 HMG (high mobility group) box
20-77 Domain of unknown function (DUF1898)
Sequence:
(in bold interface residues)
1 AEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSM 60
61 SNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIG
Interface Residues: 21, 24, 26, 27, 28, 30, 34, 45, 46, 47, 50, 52, 53, 55, 57, 58, 74, 88
3D-footprint Homologues: 3f27_D, 1qrv_A, 3u2b_C, 6jrp_D, 2gzk_A, 4s2q_D, 1j5n_A, 7m5w_A, 2lef_A, 4y60_C, 1o4x_B, 1ckt_A, 1hry_A, 6jbx_A
Binding Motifs: SOX6 caccgAACAAT
SOX6_TBX21_1 rgGTGtkryttwdksywTTGT
SOX6_TBX21_2 rgGTGtkrwwdwdrACAATrg
TEAD4_SOX6 rrACAATrgaawGGwATGy
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.