Transcription Factor
| Accessions: | PEBB_HUMAN (HOCOMOCO 10) |
| Names: | CBF-beta, Core-binding factor subunit beta, PEA2-beta, PEBB_HUMAN, PEBP2-beta, Polyomavirus enhancer-binding protein 2 beta subunit, SL3-3 enhancer factor 1 subunit beta, SL3/AKV core-binding factor beta subunit |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] |
| Length: | 182 |
| Pfam Domains: | 1-170 Core binding factor beta subunit |
| Sequence: | MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT RP |
| Binding Motifs: | PEBB_HUMAN.H10MO.C|M01431 yyTGYGGTywb |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.