Transcription Factor

Accessions: 1n6j_B (3D-footprint 20241219), 1tqe_P (3D-footprint 20241219), 1tqe_Q (3D-footprint 20241219), 1tqe_R (3D-footprint 20241219), 1tqe_S (3D-footprint 20241219), 6wc5_B (3D-footprint 20241219), 6wc5_C (3D-footprint 20241219), 6wc5_D (3D-footprint 20241219)
Names: MEF2B_HUMAN, Myocyte-specific enhancer factor 2B, RSRFR2, Serum response factor-like protein 2
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q02080
Length: 90
Pfam Domains: 9-58 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence:
(in bold interface residues)
1 GRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTD 60
61 MDRVLLKYTEYSEPHESRTNTDILETLKRR
Interface Residues: 2, 14, 22, 56, 67
3D-footprint Homologues: 8q9p_B, 7xuz_H, 8q9q_A, 8q9r_F, 8q9n_B, 7yq3_E
Binding Motifs: 1n6j_AB TawwwrtAg
1tqe_PQ CTnnnnntAa
1tqe_RS CTnnnnntAa
6wc5_ABI CnCTttCTnnnnnnAG
6wc5_CDN CTTTCynnnnnTAG
Binding Sites: 1n6j_C / 1tqe_C
1n6j_D / 1tqe_D
1tqe_E
1tqe_F
Publications: Han A, Pan F, Stroud J.C, Youn H.D, Liu J.O, Chen L. Sequence-specific recruitment of transcriptional co-repressor Cabin1 by myocyte enhancer factor-2. Nature 422:730-4 (2003). [Pubmed]

Han A, He J, Wu Y, Liu J.O, Chen L. Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2. Journal of molecular biology 345:91-102 (2005). [Pubmed]

Lei X, Zhao J, Sagendorf JM, Rajashekar N, Xu J, Dantas Machado AC, Sen C, Rohs R, Feng P, Chen L. Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface. J Mol Biol 432:5499-5508 (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.