Transcription Factor
| Accessions: | 1n6j_B (3D-footprint 20250804), 1tqe_P (3D-footprint 20250804), 1tqe_Q (3D-footprint 20250804), 1tqe_R (3D-footprint 20250804), 1tqe_S (3D-footprint 20250804), 6wc5_B (3D-footprint 20250804), 6wc5_C (3D-footprint 20250804), 6wc5_D (3D-footprint 20250804) |
| Names: | MEF2B_HUMAN, Myocyte-specific enhancer factor 2B, RSRFR2, Serum response factor-like protein 2 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q02080 |
| Length: | 90 |
| Pfam Domains: | 9-58 SRF-type transcription factor (DNA-binding and dimerisation domain) |
| Sequence: (in bold interface residues) | 1 GRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTD 60 61 MDRVLLKYTEYSEPHESRTNTDILETLKRR |
| Interface Residues: | 2, 3, 14, 17, 18, 22 |
| 3D-footprint Homologues: | 8q9p_B, 1c7u_A, 1n6j_A, 8q9q_A, 1egw_B, 7xuz_H, 8q9r_F, 1hbx_A, 8q9n_B, 1mnm_A |
| Binding Motifs: | 1n6j_AB TawwwrtAg 1tqe_PQ CTnnnnntAa 1tqe_RS CTnnnnntAa 6wc5_ABI CnCTttCTnnnnnnAG 6wc5_CDN CTTTCynnnnnTAG |
| Binding Sites: | 1n6j_C / 1tqe_C 1n6j_D / 1tqe_D 1tqe_E 1tqe_F |
| Publications: | Han A, Pan F, Stroud J.C, Youn H.D, Liu J.O, Chen L. Sequence-specific recruitment of transcriptional co-repressor Cabin1 by myocyte enhancer factor-2. Nature 422:730-4 (2003). [Pubmed] Han A, He J, Wu Y, Liu J.O, Chen L. Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2. Journal of molecular biology 345:91-102 (2005). [Pubmed] Lei X, Zhao J, Sagendorf JM, Rajashekar N, Xu J, Dantas Machado AC, Sen C, Rohs R, Feng P, Chen L. Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface. J Mol Biol 432:5499-5508 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.