Transcription Factor

Accessions: FOXB1_DBD (HumanTF 1.0), FOXB1 (HT-SELEX2 May2017)
Names: Forkhead box protein B1, FOXB1, FOXB1_HUMAN, Transcription factor FKH-5, ENSG00000171956
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q99853
Notes: Ensembl ID: ENSG00000171956; DNA-binding domain sequence; TF family: Forkhead; Clone source: Gene synthesis, TF family: Forkhead experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: Forkhead experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3
Length: 128
Pfam Domains: 12-107 Fork head domain
Sequence:
(in bold interface residues)
1 PRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSL 60
61 RHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSK 120
121 PADAAQYL
Interface Residues: 35, 52, 54, 55, 57, 58, 59, 61, 62, 63, 65, 66, 75, 82, 90, 91, 92, 94, 95, 100, 103, 104, 107
3D-footprint Homologues: 8vfz_O, 3l2c_A, 8bzm_E, 7vox_H, 2hdc_A, 2a07_J, 7yzb_A, 6nce_A, 3co6_C, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 3g73_A, 6ako_C, 7yzg_A, 7tdw_A, 7yz7_A, 6el8_A, 2uzk_A, 7tdx_A, 3qrf_G, 8sro_B, 5j2y_A
Binding Motifs: FOXB1_DBD_1 gAATGACACrGCga
FOXB1_DBD_2 watGTMAATATTKACayw
FOXB1_DBD_3 wAwGTMAAyAt
FOXB1_2 ywrwGyMAATATTkACwywr
FOXB1_methyl_1 ywrwGyMAATATTkACwywr
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.