Transcription Factor

Accessions: disco-r-F1-2 (FlyZincFinger 1.0 )
Names: CG32577
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 155
Sequence:
(in bold interface residues)
1 GGAGGNGGSVGGGGGKRQWGSMPANLGTQFINPVTGKKRVQCNVCLKTFCDKGALKIHFS 60
61 AVHLREMHKCTVDGCSMMFSSRRSRNRHSANPNPKLHSPHLRRKISPHDGRSAQPHPLLL 120
121 QAPNGLMAGLAPFGSFPLLTPPPDLRHHAMGGSGA
Interface Residues: 21, 22, 24, 25, 29, 50, 51, 52, 53, 54, 56, 57, 81, 82, 83, 84, 86, 87
3D-footprint Homologues: 8h9h_G, 7eyi_G, 7n5w_A, 1g2f_F, 4x9j_A, 1f2i_J, 7w1m_H, 6ml4_A, 7y3l_A, 2lt7_A, 8ssq_A, 7y3m_I, 8cuc_F, 7txc_E
Binding Motifs: disco-r-F1-2_SOLEXA_FBgn0042650 kkykGGTGACAhttt
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.