Transcription Factor

Accessions: ZSCAN1 (HT-SELEX2 May2017)
Names: ENSG00000152467, ZSCAN1
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2
Length: 136
Pfam Domains: 20-42 C2H2-type zinc finger
20-42 Zinc finger, C2H2 type
20-44 C2H2-type zinc finger
37-59 Zinc-finger double domain
48-66 C2H2-type zinc finger
48-70 Zinc finger, C2H2 type
48-58 C2H2-type zinc finger
104-117 Zinc-finger double domain
108-130 Zinc finger, C2H2 type
108-130 C2H2-type zinc finger
108-130 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 QEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHN 60
61 SVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWM 120
121 VHLIDHQKLHTAHGHM
Interface Residues: 5, 7, 9, 12, 20, 30, 31, 32, 33, 34, 36, 37, 38, 58, 59, 60, 61, 62, 63, 64, 65, 66, 69, 82, 85, 86, 87, 89, 90, 92, 93, 94, 95, 96, 97, 98, 99, 118, 119, 120, 121, 122, 125
3D-footprint Homologues: 6e94_A, 7n5w_A, 8h9h_G, 2kmk_A, 1g2f_F, 8cuc_F, 7y3l_A, 1tf3_A, 3uk3_C, 7w1m_H, 5k5i_A, 6u9q_A, 1ubd_C, 8ssu_A, 5kkq_D, 2lt7_A, 1llm_D, 8gn3_A, 4x9j_A, 2drp_D, 6jnm_A, 5kl3_A, 5ei9_F, 2jpa_A, 6ml4_A, 5v3j_F, 8ssq_A, 4m9v_C, 7y3m_I, 7ysf_A, 6a57_A, 5yel_A, 5yj3_D, 2wbs_A, 7txc_E, 1f2i_J, 1tf6_A, 6blw_A
Binding Motifs: ZSCAN1_2 myRCACACvCTGamAaw
ZSCAN1_methyl_1 syGCACACmCTGamAah
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.