Transcription Factor
| Accessions: | ZSCAN1 (HT-SELEX2 May2017) |
| Names: | ENSG00000152467, ZSCAN1 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 136 |
| Pfam Domains: | 20-42 C2H2-type zinc finger 20-42 Zinc finger, C2H2 type 20-44 C2H2-type zinc finger 37-59 Zinc-finger double domain 48-66 C2H2-type zinc finger 48-70 Zinc finger, C2H2 type 48-58 C2H2-type zinc finger 104-117 Zinc-finger double domain 108-130 Zinc finger, C2H2 type 108-130 C2H2-type zinc finger 108-130 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 QEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHN 60 61 SVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWM 120 121 VHLIDHQKLHTAHGHM |
| Interface Residues: | 5, 7, 9, 12, 20, 30, 31, 32, 33, 34, 36, 37, 38, 58, 59, 60, 61, 62, 63, 64, 65, 66, 69, 82, 85, 86, 87, 89, 90, 92, 93, 94, 95, 96, 97, 98, 99, 118, 119, 120, 121, 122, 125 |
| 3D-footprint Homologues: | 6e94_A, 7n5w_A, 8h9h_G, 2kmk_A, 1g2f_F, 8cuc_F, 7y3l_A, 1tf3_A, 3uk3_C, 7w1m_H, 5k5i_A, 6u9q_A, 1ubd_C, 8ssu_A, 5kkq_D, 2lt7_A, 1llm_D, 8gn3_A, 4x9j_A, 2drp_D, 6jnm_A, 5kl3_A, 5ei9_F, 2jpa_A, 6ml4_A, 5v3j_F, 8ssq_A, 4m9v_C, 7y3m_I, 7ysf_A, 6a57_A, 5yel_A, 5yj3_D, 2wbs_A, 7txc_E, 1f2i_J, 1tf6_A, 6blw_A |
| Binding Motifs: | ZSCAN1_2 myRCACACvCTGamAaw ZSCAN1_methyl_1 syGCACACmCTGamAah |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.