Transcription Factor
| Accessions: | Q3KNT2 (JASPAR 2024) |
| Names: | ETS translocation variant 2, ETV2 protein, Q3KNT2_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q3KNT2 |
| Length: | 155 |
| Pfam Domains: | 54-134 Ets-domain |
| Sequence: (in bold interface residues) | 1 MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGPIQLWQFL 60 61 LELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDI 120 121 VRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ |
| Interface Residues: | 106, 107, 109, 110, 111, 113, 114, 128 |
| 3D-footprint Homologues: | 4mhg_A, 8smh_F, 4uno_A, 2stt_A, 8smj_F, 7jsa_J, 3jtg_A, 1dux_F, 8ee9_F, 3zp5_A, 1yo5_C, 4iri_A, 1awc_A, 4l18_B, 1bc8_C, 4lg0_B |
| Binding Motifs: | MA0762.1 aACCGGAARYr UN0510.1 rsCGGAwrTTrCGyAAy MA1940.1 rsCGGAWryaATTA UN0511.1 TcrCRCMGGAwry MA1942.1 sgtaaACAGGAwRyr UN0513.1 rcCGGAAryrtmmACAy UN0514.1 rcCGGATGTTkw UN0515.1 TGTtkmCGGAWGtg UN0516.1 rCCGGAWGTTkwy UN0517.1 mGCAGCTGCCGGAWgyw UN0518.1 rrTCrATAmCGGAAryr UN0519.1 rATCrATaacCGGAAryg UN0520.1 vsMGGAmGGAwrTCCGsyt UN0521.1 vTsrSGTGACGGAAry UN0522.1 rCCGGAwrTTACGTAAy MA0762.2 ACCGGAARY MA1940.2 CGGAWryaATTA MA1942.2 aaACAGGAwRy UN0510.2 sCGGAwrTTrCGyAA UN0511.2 TcrCRCMGGAwr UN0513.2 cCGGAAryrtmmACA UN0514.2 rcCGGATGTTk UN0515.2 TGTtkmCGGAWGt UN0516.2 rCCGGAWGTTk UN0517.2 mGCAGCTGCCGGAWgy UN0518.2 rTCrATAmCGGAAry UN0519.2 rATCrATaacCGGAAry UN0520.2 MGGAmGGAwrTCCGs UN0521.2 vTsrSGTGACGGAAr UN0522.2 CCGGAwrTTACGTAAy |
| Publications: | Wei G-H, Badis G, Berger MF, Kivioja T, Palin K, Enge M, Bonke M, Jolma A, Varjosalo M, Gehrke AR, Yan J, Talukder S, Turunen M, Taipale M, Stunnenberg HG, Ukkonen E, Hughes TR, Bulyk ML, Taipale J. Genome-wide analysis of ETS family DNA-binding in vitro and in vivo. The EMBO Journal. Epub 2010 Jun 1. doi:10.1038/emboj.2010.106 [Pubmed] De Val S., Chi N. C., Meadows S. M., Minovitsky S., Anderson J. P., Harris I. S., Ehlers M. L., Agarwal P., Visel A., Xu S. M., Pennacchio L. A., Dubchak I., Krieg P. A., Stainier D. Y., Black B. L. Combinatorial regulation of endothelial gene expression by ets and forkhead transcription factors.. Cell 135:1053-1064 (2008). [Pubmed] Guturu H, Doxey AC, Wenger AM, Bejerano G. Structure-aided prediction of mammalian transcription factor complexes in conserved non-coding elements. Philos Trans R Soc Lond B Biol Sci 368:20130029 (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.