Transcription Factor

Accessions: 1ddn_A (3D-footprint 20231221), 1ddn_B (3D-footprint 20231221), 1ddn_C (3D-footprint 20231221), 1ddn_D (3D-footprint 20231221)
Names: DIPHTHERIA TOX REPRESSOR, Diphtheria toxin repressor, DTXR_CORDI, Iron-dependent diphtheria tox regulatory element, Tox regulatory factor
Organisms: Corynebacterium diphtheriae, strain ATCC 700971 / NCTC 13129 / Biotype gravis
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0DJL7
Length: 118
Pfam Domains: 1-60 Iron dependent repressor, N-terminal DNA binding domain
63-118 Iron dependent repressor, metal binding and dimerisation domain
Sequence:
(in bold interface residues)
1 DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSL 60
61 QMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVL
Interface Residues: 25, 35, 36, 37, 38, 39, 40, 41, 42, 45
3D-footprint Homologues: 3jso_B, 1f5t_A, 4lln_I, 1u8r_B, 7b24_C, 2isz_B, 1ddn_B
Binding Motifs: 1ddn_ABCD AGGAtAGCTTnACCT
1ddn_B TTAGGT
Binding Sites: 1ddn_E
1ddn_F
Publications: White A, Ding X, vanderSpek J.C, Murphy J.R, Ringe D. Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex. Nature 394:502-6 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.