Transcription Factor
Accessions: | 1ddn_A (3D-footprint 20231221), 1ddn_B (3D-footprint 20231221), 1ddn_C (3D-footprint 20231221), 1ddn_D (3D-footprint 20231221) |
Names: | DIPHTHERIA TOX REPRESSOR, Diphtheria toxin repressor, DTXR_CORDI, Iron-dependent diphtheria tox regulatory element, Tox regulatory factor |
Organisms: | Corynebacterium diphtheriae, strain ATCC 700971 / NCTC 13129 / Biotype gravis |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P0DJL7 |
Length: | 118 |
Pfam Domains: | 1-60 Iron dependent repressor, N-terminal DNA binding domain 63-118 Iron dependent repressor, metal binding and dimerisation domain |
Sequence: (in bold interface residues) | 1 DLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSL 60 61 QMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEADRWEHVMSDEVERRLVKVL |
Interface Residues: | 25, 35, 36, 37, 38, 39, 40, 41, 42, 45 |
3D-footprint Homologues: | 3jso_B, 1f5t_A, 4lln_I, 1u8r_B, 7b24_C, 2isz_B, 1ddn_B |
Binding Motifs: | 1ddn_ABCD AGGAtAGCTTnACCT 1ddn_B TTAGGT |
Binding Sites: | 1ddn_E 1ddn_F |
Publications: | White A, Ding X, vanderSpek J.C, Murphy J.R, Ringe D. Structure of the metal-ion-activated diphtheria toxin repressor/tox operator complex. Nature 394:502-6 (1998). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.