Transcription Factor

						

			
Accessions: 1pue_E (3D-footprint 20231221)

			
Names: 31 kDa-transforming protein, SFFV proviral integration 1 protein, SPI1_MOUSE, TRANSCRIPTION FACTOR PU.1 (TF PU.1)
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P17433
Length: 88
Pfam Domains:      1-85 Ets-domain
Sequence: 
(in bold interface residues)		   1 KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKM   60
  61 ARALRNYGKTGEVKKVKKKLTYQFSGEV
Interface Residues: 37, 58, 59, 61, 62, 63, 65, 66, 79
3D-footprint Homologues: 1if1_B, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 1dux_F, 4uno_A, 3jtg_A, 4l18_B, 1awc_A, 4lg0_B, 1yo5_C, 4bqa_A, 1bc8_C, 4iri_A
Binding Motifs: 1pue_E GGGRm
Binding Sites: 1pue_A
1pue_B
			
Publications: Kodandapani R., Pio F., Ni C.-Z., Piccialli G., Klemsz M., McKercher S., Maki R. A., Ely K. R. A new pattern for helix-turn-helix recognition revealed by the PU.1 ETS-domain-DNA complex. Nature 380:456-460 (1996). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.