Transcription Factor
| Accessions: | ZNF460 (HT-SELEX2 May2017) |
| Names: | ENSG00000197714, ZNF460 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 3b0, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3b0 |
| Length: | 346 |
| Pfam Domains: | 9-32 Zinc-finger double domain 22-43 C2H2-type zinc finger 22-44 Zinc finger, C2H2 type 22-40 C2H2-type zinc finger 36-60 Zinc-finger double domain 49-72 C2H2-type zinc finger 50-73 C2H2-type zinc finger 50-72 Zinc finger, C2H2 type 64-88 Zinc-finger double domain 78-100 C2H2-type zinc finger 78-100 Zinc finger, C2H2 type 78-101 C2H2-type zinc finger 92-117 Zinc-finger double domain 106-128 Zinc finger, C2H2 type 106-129 C2H2-type zinc finger 106-124 C2H2-type zinc finger 120-144 Zinc-finger double domain 134-152 C2H2-type zinc finger 134-156 C2H2-type zinc finger 149-172 Zinc-finger double domain 162-184 Zinc finger, C2H2 type 162-173 C2H2-type zinc finger 162-184 C2H2-type zinc finger 176-201 Zinc-finger double domain 190-212 C2H2-type zinc finger 190-212 Zinc finger, C2H2 type 190-208 C2H2-type zinc finger 207-228 Zinc-finger double domain 217-236 C2H2-type zinc finger 218-240 C2H2-type zinc finger 218-240 Zinc finger, C2H2 type 233-257 Zinc-finger double domain 245-264 C2H2-type zinc finger 246-265 C2H2-type zinc finger 246-265 Zinc finger, C2H2 type 261-283 Zinc-finger double domain 274-294 C2H2-type zinc finger 274-296 Zinc finger, C2H2 type 274-292 C2H2-type zinc finger 288-312 Zinc-finger double domain 301-322 C2H2-type zinc finger 302-324 C2H2-type zinc finger 302-324 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 EMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHLLQHHIIHTGEKPYKCLECGKDFN 60 61 RRSHLTRHQRTHNGDKPFVCSECGRTFNRGSHLTRHQRVHSGEKPFVCNECGKAFTYRSN 120 121 FVLHNKSHNEKKPFACSECGKGFYESTALIQHFIIHTGERPFKCLECGKAFNCRSHLKQH 180 181 ERIHTGEKPFVCSQCGKAFTHYSTYVLHERAHTGEKPFECKECGKAFSIRKDLIRHFNIH 240 241 TGEKPYECLQCGKAFTRMSGLTRHQWIHTGEKPYVCIQCGKAFCRTTNLIRHFSIHTGEK 300 301 PYECVECGKAFNRRSPLTRHQRIHTAEKSHEPIQSGNVSCESTDLI |
| Interface Residues: | 33, 35, 36, 38, 39, 41, 42, 45, 60, 61, 62, 63, 64, 66, 67, 88, 89, 90, 91, 92, 95, 96, 116, 117, 118, 119, 120, 121, 122, 123, 124, 126, 127, 134, 144, 145, 146, 147, 148, 151, 172, 173, 175, 176, 179, 183, 201, 202, 203, 204, 207, 228, 229, 230, 231, 232, 234, 235, 238, 256, 257, 259, 260, 262, 263, 269, 283, 284, 285, 286, 287, 288, 290, 291, 295, 312, 313, 314, 315, 316, 319 |
| 3D-footprint Homologues: | 1g2f_F, 5k5l_F, 8ssu_A, 4x9j_A, 6blw_A, 5yel_A, 1mey_C, 1f2i_J, 8ssq_A, 7ysf_A, 2jpa_A, 6jnm_A, 1tf6_A, 1llm_D, 2wbs_A, 5ei9_F, 5kl3_A, 6wmi_A, 7w1m_H, 5und_A, 6a57_A, 7y3l_A, 3uk3_C, 8cuc_F, 5v3j_F, 4m9v_C, 7y3m_I, 2kmk_A, 2gli_A, 6e94_A, 2i13_A, 5kkq_D, 6ml4_A, 6u9q_A, 7txc_E, 7n5w_A, 1tf3_A, 8gn3_A, 5k5i_A, 7eyi_G, 8h9h_G, 2lt7_A, 1ubd_C, 2drp_D, 5yj3_D |
| Binding Motifs: | ZNF460_2 cAACGCCCCCCGm ZNF460_methyl_1 caaCgCCCCCCsm |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.