Transcription Factor

						

			
Accessions: ZNF343 (HT-SELEX2 May2017)

			
Names: ENSG00000088876, ZNF343
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4
Length: 234
Pfam Domains:     20-38 C2H2-type zinc finger
    20-40 C2H2-type zinc finger
    20-42 Zinc finger, C2H2 type
    35-58 Zinc-finger double domain
    48-71 C2H2-type zinc finger
    48-70 C2H2-type zinc finger
    48-70 Zinc finger, C2H2 type
    62-86 Zinc-finger double domain
    76-91 C2H2-type zinc finger
    76-98 C2H2-type zinc finger
   91-114 Zinc-finger double domain
  104-127 C2H2-type zinc finger
  104-126 C2H2-type zinc finger
  104-126 Zinc finger, C2H2 type
  121-141 Zinc-finger double domain
  132-154 Zinc finger, C2H2 type
  132-152 C2H2-type zinc finger
  132-154 C2H2-type zinc finger
  147-170 Zinc-finger double domain
  160-182 C2H2-type zinc finger
  160-182 Zinc finger, C2H2 type
  160-183 C2H2-type zinc finger
  175-197 Zinc-finger double domain
  188-210 Zinc finger, C2H2 type
  188-206 C2H2-type zinc finger
  205-226 Zinc-finger double domain
  216-227 C2H2-type zinc finger
  216-234 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 HNLESNFITNPRTLLGKKPYICSDCGRSFKDRSTLIRHHRIHSMEKPYVCSECGRGFSQK   60
  61 SNLSRHQRTHSEEKPYLCRECGQSFRSKSILNRHQWTHSEEKPYVCSECGRGFSEKSSFI  120
 121 RHQRTHSGEKPYVCLECGRSFCDKSTLRKHQRIHSGEKPYVCRECGRGFSQNSDLIKHQR  180
 181 THLDEKPYVCRECGRGFCDKSTLIIHERTHSGEKPYVCGECGRGFSRKSLLLVH
Interface Residues: 5, 9, 30, 31, 33, 34, 37, 41, 59, 60, 61, 62, 65, 66, 86, 87, 88, 89, 90, 91, 92, 93, 94, 96, 114, 115, 116, 117, 118, 120, 121, 123, 124, 126, 127, 132, 143, 144, 145, 146, 147, 148, 149, 152, 170, 171, 172, 173, 174, 176, 177, 183, 197, 198, 199, 200, 201, 202, 204, 205, 209, 226, 227, 228, 229, 230, 233
3D-footprint Homologues: 7w1m_H, 1tf3_A, 8ssq_A, 8ssu_A, 8gn3_A, 6u9q_A, 5yel_A, 1g2f_F, 6wmi_A, 5v3j_F, 2i13_A, 6ml4_A, 5yj3_D, 5und_A, 4m9v_C, 7ysf_A, 1tf6_A, 5kkq_D, 1ubd_C, 6jnm_A, 7n5w_A, 3uk3_C, 4x9j_A, 6blw_A, 5ei9_F, 1mey_C, 5kl3_A, 2drp_D, 5k5i_A, 2gli_A, 7eyi_G, 8h9h_G, 6a57_A, 2jpa_A, 6dta_B, 2kmk_A, 5k5l_F, 2wbs_A, 1f2i_J, 2lt7_A, 6e94_A, 7txc_E, 8cuc_F, 7y3l_A, 1llm_D, 7y3m_I
Binding Motifs: ZNF343_2 cCGCTTCmCcrCGGymv
ZNF343_methyl_1 sCGCTTCACcrCGGyar
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.