Transcription Factor
| Accessions: | 3clc_B (3D-footprint 20260701), 3clc_C (3D-footprint 20260701), 3ufd_B (3D-footprint 20260701), 4x4b_B (3D-footprint 20260701), 4x4b_C (3D-footprint 20260701), 4x4c_B (3D-footprint 20260701), 4x4c_C (3D-footprint 20260701), 4x4d_B (3D-footprint 20260701), 4x4d_C (3D-footprint 20260701), 4x4e_B (3D-footprint 20260701), 4x4e_C (3D-footprint 20260701), 4x4f_B (3D-footprint 20260701), 4x4f_C (3D-footprint 20260701), 4x4g_B (3D-footprint 20260701), 4x4g_C (3D-footprint 20260701), 4x4h_B (3D-footprint 20260701), 4x4h_C (3D-footprint 20260701), 4x4i_B (3D-footprint 20260701), 4x4i_C (3D-footprint 20260701) |
| Names: | Q8GGH0_9ENTR, Regulatory protein |
| Organisms: | Enterobacter sp. RFL1396 |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q8GGH0 |
| Length: | 77 |
| Pfam Domains: | 12-62 Helix-turn-helix 12-62 Helix-turn-helix domain |
| Sequence: (in bold interface residues) | 1 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLE 60 61 VSDVVFFEMLIKEILKH |
| Interface Residues: | 24, 33, 34, 35, 36, 38, 39, 42, 44, 45 |
| 3D-footprint Homologues: | 3s8q_A, 3zkc_A, 8ity_P, 3u3w_B |
| Binding Motifs: | 4x4h_C CaCa 3clc_ABCD TGTnGACnnnnGnCACACGGnCnnnnATTCACA 3clc_B CGgac 3ufd_AB TGTCGACTATAGTCTACA 4x4b_ABCD TGTnGAcnnnnTnCACrCnGannnnnAGTcACA 4x4b_C / 4x4d_C tGtG 4x4c_ABCD TGTGACTnnnnnTCnGCGTGnAnnnnGTCnACA 4x4c_C tGtG 4x4d_ABCD TGTGACTnnnnntCnGyGTGnAnnnngTCnACA 4x4e_ABCD TGTnGACnnnnTnCACRCnGannnnnAGTcACA 4x4e_C tGtG 4x4f_ABCD TGTGACTnnnnntCnGyGTGnAnnnnGTCnACA 4x4f_C / 4x4g_C CaCa 4x4g_ABCD TGTnGACnnnnTnCACRCnGAnnnnnAGTCACA 4x4h_ABCD TGTGACTnnnnntCnGyGTGnAnnnngTCnACA 4x4i_ABCD TGTGACTnnnnnTCnGYGTGnAnnnnGTCnACA 4x4i_C CaCa |
| Binding Sites: | 3clc_E / 4x4b_E / 4x4c_E / 4x4d_E / 4x4e_E / 4x4f_E / 4x4g_E / 4x4h_E / 4x4i_E 3clc_F / 4x4b_F / 4x4c_F / 4x4d_F / 4x4e_F / 4x4f_F / 4x4g_F / 4x4h_F / 4x4i_F 3ufd_C 3ufd_D |
| Publications: | McGeehan J.E, Streeter S.D, Thresh S.J, Ball N, Ravelli R.B, Kneale G.G. Structural analysis of the genetic switch that regulates the expression of restriction-modification genes. Nucleic acids research 36:4778-87 (2008). [Pubmed] Ball N.J, McGeehan J.E, Streeter S.D, Thresh S.J, Kneale G.G. The structural basis of differential DNA sequence recognition by restriction-modification controller proteins. Nucleic acids research 40:10532-42 (2012). [Pubmed] Bury C, Garman EF, Ginn HM, Ravelli RB, Carmichael I, Kneale G, McGeehan JE. Radiation damage to nucleoprotein complexes in macromolecular crystallography. J Synchrotron Radiat 22:213-24 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.