Transcription Factor
| Accessions: | 3a01_E (3D-footprint 20231221) |
| Names: | Homeodomain-containing protein, Q9VD99_DROME |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9VD99 |
| Length: | 68 |
| Pfam Domains: | 9-63 Homeobox domain 15-59 Homeodomain leucine-zipper encoding, Homez |
| Sequence: (in bold interface residues) | 1 HPYQNRTPPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTK 60 61 WRRQTAEE |
| Interface Residues: | 1, 6, 10, 48, 49, 50, 51, 52, 55, 56, 59, 60, 63 |
| 3D-footprint Homologues: | 3a01_E, 2ld5_A, 1fjl_B, 5zjt_E, 2h1k_B, 6m3d_C, 1b72_A, 5hod_A, 3lnq_A, 2lkx_A, 1puf_A, 1ig7_A, 6a8r_A, 3cmy_A, 2hdd_A, 7psx_B, 5jlw_D, 3rkq_B, 2r5y_A, 1jgg_B, 6es3_K, 4xrs_G, 3d1n_M, 2hos_A, 1nk2_P, 7q3o_C, 5zfz_A, 4cyc_A, 5flv_I, 7xrc_C, 4j19_B, 1le8_A, 1e3o_C, 2xsd_C, 1au7_A, 3l1p_A, 1o4x_A, 8g87_X, 4qtr_D, 1mnm_C, 1du0_A, 1puf_B, 1zq3_P, 1k61_B, 6fqq_E |
| Binding Motifs: | 3a01_E TaATTG |
| Binding Sites: | 3a01_G 3a01_H |
| Publications: | Miyazono K, Zhi Y, Takamura Y, Nagata K, Saigo K, Kojima T, Tanokura M. Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless. The EMBO journal 29:1613-23 (2010). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.